data_2HID # _entry.id 2HID # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HID pdb_00002hid 10.2210/pdb2hid/pdb WWPDB D_1000178195 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 1996-11-08 _pdbx_database_PDB_obs_spr.pdb_id 2HID _pdbx_database_PDB_obs_spr.replace_pdb_id 1HID _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HID _pdbx_database_status.recvd_initial_deposition_date 1996-05-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jones, B.E.' 1 'Rajagopal, P.' 2 'Klevit, R.E.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Phosphorylation on histidine is accompanied by localized structural changes in the phosphocarrier protein, HPr from Bacillus subtilis. ; 'Protein Sci.' 6 2107 2119 1997 PRCIEI US 0961-8368 0795 ? 9336834 ? 1 'Solution Structure of the Phosphocarrier Protein Hpr from Bacillus Subtilis by Two-Dimensional NMR Spectroscopy' 'Protein Sci.' 1 1363 ? 1992 PRCIEI US 0961-8368 0795 ? ? ? 2 ;Sequence-Specific 1H NMR Resonance Assignments of Bacillus Subtilis Hpr: Use of Spectra Obtained from Mutants to Resolve Spectral Overlap ; Biochemistry 29 7191 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 3 ;Common Structural Changes Accompany the Functional Inactivation of Hpr by Seryl Phosphorylation or by Serine to Aspartate Substitution ; Biochemistry 28 9908 ? 1989 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jones, B.E.' 1 ? primary 'Rajagopal, P.' 2 ? primary 'Klevit, R.E.' 3 ? 1 'Wittekind, M.' 4 ? 1 'Rajagopal, P.' 5 ? 1 'Branchini, B.R.' 6 ? 1 'Reizer, J.' 7 ? 1 'Saier Junior, M.H.' 8 ? 1 'Klevit, R.E.' 9 ? 2 'Wittekind, M.' 10 ? 2 'Reizer, J.' 11 ? 2 'Klevit, R.E.' 12 ? 3 'Wittekind, M.' 13 ? 3 'Reizer, J.' 14 ? 3 'Deutscher, J.' 15 ? 3 'Saier, M.H.' 16 ? 3 'Klevit, R.E.' 17 ? # _cell.entry_id 2HID _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2HID _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HISTIDINE CONTAINING PROTEIN' _entity.formula_weight 9035.073 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation M51V _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name HPR # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVVSLGIAKGAEITISASGADENDALNALEETM KSEGLGE ; _entity_poly.pdbx_seq_one_letter_code_can ;AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVVSLGIAKGAEITISASGADENDALNALEETM KSEGLGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 LYS n 1 4 THR n 1 5 PHE n 1 6 LYS n 1 7 VAL n 1 8 THR n 1 9 ALA n 1 10 ASP n 1 11 SER n 1 12 GLY n 1 13 ILE n 1 14 HIS n 1 15 ALA n 1 16 ARG n 1 17 PRO n 1 18 ALA n 1 19 THR n 1 20 VAL n 1 21 LEU n 1 22 VAL n 1 23 GLN n 1 24 THR n 1 25 ALA n 1 26 SER n 1 27 LYS n 1 28 TYR n 1 29 ASP n 1 30 ALA n 1 31 ASP n 1 32 VAL n 1 33 ASN n 1 34 LEU n 1 35 GLU n 1 36 TYR n 1 37 ASN n 1 38 GLY n 1 39 LYS n 1 40 THR n 1 41 VAL n 1 42 ASN n 1 43 LEU n 1 44 LYS n 1 45 SER n 1 46 ILE n 1 47 MET n 1 48 GLY n 1 49 VAL n 1 50 VAL n 1 51 SER n 1 52 LEU n 1 53 GLY n 1 54 ILE n 1 55 ALA n 1 56 LYS n 1 57 GLY n 1 58 ALA n 1 59 GLU n 1 60 ILE n 1 61 THR n 1 62 ILE n 1 63 SER n 1 64 ALA n 1 65 SER n 1 66 GLY n 1 67 ALA n 1 68 ASP n 1 69 GLU n 1 70 ASN n 1 71 ASP n 1 72 ALA n 1 73 LEU n 1 74 ASN n 1 75 ALA n 1 76 LEU n 1 77 GLU n 1 78 GLU n 1 79 THR n 1 80 MET n 1 81 LYS n 1 82 SER n 1 83 GLU n 1 84 GLY n 1 85 LEU n 1 86 GLY n 1 87 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTHP_BACSU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P08877 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEETM KSEGLGE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HID _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08877 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 88 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2HID _struct_ref_seq_dif.mon_id VAL _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 50 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P08877 _struct_ref_seq_dif.db_mon_id MET _struct_ref_seq_dif.pdbx_seq_db_seq_num 50 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 51 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_details.entry_id 2HID _pdbx_nmr_details.text '50 MM PHOSPHATE BUFFER' # _pdbx_nmr_ensemble.entry_id 2HID _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 2HID _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2HID _struct.title 'REFINED NMR STRUCTURE OF PHOSPHOCARRIER HISTIDINE CONTAINING PROTEIN FROM BACILLUS SUBTILIS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HID _struct_keywords.pdbx_keywords PHOSPHOTRANSFERASE _struct_keywords.text 'HISTIDINE CONTAINING PROTEIN, PHOSPHOTRANSFERASE, PTS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 15 ? LYS A 27 ? ALA A 16 LYS A 28 1 ? 13 HELX_P HELX_P2 2 ILE A 46 ? LEU A 52 ? ILE A 47 LEU A 53 1 ? 7 HELX_P HELX_P3 3 GLU A 69 ? GLU A 83 ? GLU A 70 GLU A 84 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 2 ? VAL A 7 ? GLN A 3 VAL A 8 A 2 ALA A 58 ? SER A 65 ? ALA A 59 SER A 66 A 3 ASP A 31 ? TYR A 36 ? ASP A 32 TYR A 37 A 4 LYS A 39 ? ASN A 42 ? LYS A 40 ASN A 43 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 3 ? O LYS A 4 N ILE A 62 ? N ILE A 63 A 2 3 O THR A 61 ? O THR A 62 N GLU A 35 ? N GLU A 36 A 3 4 O LEU A 34 ? O LEU A 35 N VAL A 41 ? N VAL A 42 # _database_PDB_matrix.entry_id 2HID _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2HID _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 GLN 2 3 3 GLN GLN A . n A 1 3 LYS 3 4 4 LYS LYS A . n A 1 4 THR 4 5 5 THR THR A . n A 1 5 PHE 5 6 6 PHE PHE A . n A 1 6 LYS 6 7 7 LYS LYS A . n A 1 7 VAL 7 8 8 VAL VAL A . n A 1 8 THR 8 9 9 THR THR A . n A 1 9 ALA 9 10 10 ALA ALA A . n A 1 10 ASP 10 11 11 ASP ASP A . n A 1 11 SER 11 12 12 SER SER A . n A 1 12 GLY 12 13 13 GLY GLY A . n A 1 13 ILE 13 14 14 ILE ILE A . n A 1 14 HIS 14 15 15 HIS HIS A . n A 1 15 ALA 15 16 16 ALA ALA A . n A 1 16 ARG 16 17 17 ARG ARG A . n A 1 17 PRO 17 18 18 PRO PRO A . n A 1 18 ALA 18 19 19 ALA ALA A . n A 1 19 THR 19 20 20 THR THR A . n A 1 20 VAL 20 21 21 VAL VAL A . n A 1 21 LEU 21 22 22 LEU LEU A . n A 1 22 VAL 22 23 23 VAL VAL A . n A 1 23 GLN 23 24 24 GLN GLN A . n A 1 24 THR 24 25 25 THR THR A . n A 1 25 ALA 25 26 26 ALA ALA A . n A 1 26 SER 26 27 27 SER SER A . n A 1 27 LYS 27 28 28 LYS LYS A . n A 1 28 TYR 28 29 29 TYR TYR A . n A 1 29 ASP 29 30 30 ASP ASP A . n A 1 30 ALA 30 31 31 ALA ALA A . n A 1 31 ASP 31 32 32 ASP ASP A . n A 1 32 VAL 32 33 33 VAL VAL A . n A 1 33 ASN 33 34 34 ASN ASN A . n A 1 34 LEU 34 35 35 LEU LEU A . n A 1 35 GLU 35 36 36 GLU GLU A . n A 1 36 TYR 36 37 37 TYR TYR A . n A 1 37 ASN 37 38 38 ASN ASN A . n A 1 38 GLY 38 39 39 GLY GLY A . n A 1 39 LYS 39 40 40 LYS LYS A . n A 1 40 THR 40 41 41 THR THR A . n A 1 41 VAL 41 42 42 VAL VAL A . n A 1 42 ASN 42 43 43 ASN ASN A . n A 1 43 LEU 43 44 44 LEU LEU A . n A 1 44 LYS 44 45 45 LYS LYS A . n A 1 45 SER 45 46 46 SER SER A . n A 1 46 ILE 46 47 47 ILE ILE A . n A 1 47 MET 47 48 48 MET MET A . n A 1 48 GLY 48 49 49 GLY GLY A . n A 1 49 VAL 49 50 50 VAL VAL A . n A 1 50 VAL 50 51 51 VAL VAL A . n A 1 51 SER 51 52 52 SER SER A . n A 1 52 LEU 52 53 53 LEU LEU A . n A 1 53 GLY 53 54 54 GLY GLY A . n A 1 54 ILE 54 55 55 ILE ILE A . n A 1 55 ALA 55 56 56 ALA ALA A . n A 1 56 LYS 56 57 57 LYS LYS A . n A 1 57 GLY 57 58 58 GLY GLY A . n A 1 58 ALA 58 59 59 ALA ALA A . n A 1 59 GLU 59 60 60 GLU GLU A . n A 1 60 ILE 60 61 61 ILE ILE A . n A 1 61 THR 61 62 62 THR THR A . n A 1 62 ILE 62 63 63 ILE ILE A . n A 1 63 SER 63 64 64 SER SER A . n A 1 64 ALA 64 65 65 ALA ALA A . n A 1 65 SER 65 66 66 SER SER A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 ALA 67 68 68 ALA ALA A . n A 1 68 ASP 68 69 69 ASP ASP A . n A 1 69 GLU 69 70 70 GLU GLU A . n A 1 70 ASN 70 71 71 ASN ASN A . n A 1 71 ASP 71 72 72 ASP ASP A . n A 1 72 ALA 72 73 73 ALA ALA A . n A 1 73 LEU 73 74 74 LEU LEU A . n A 1 74 ASN 74 75 75 ASN ASN A . n A 1 75 ALA 75 76 76 ALA ALA A . n A 1 76 LEU 76 77 77 LEU LEU A . n A 1 77 GLU 77 78 78 GLU GLU A . n A 1 78 GLU 78 79 79 GLU GLU A . n A 1 79 THR 79 80 80 THR THR A . n A 1 80 MET 80 81 81 MET MET A . n A 1 81 LYS 81 82 82 LYS LYS A . n A 1 82 SER 82 83 83 SER SER A . n A 1 83 GLU 83 84 84 GLU GLU A . n A 1 84 GLY 84 85 85 GLY GLY A . n A 1 85 LEU 85 86 86 LEU LEU A . n A 1 86 GLY 86 87 87 GLY GLY A . n A 1 87 GLU 87 88 88 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-11-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 3 ? ? -173.37 -172.55 2 1 SER A 12 ? ? 169.34 -34.94 3 1 HIS A 15 ? ? -123.35 -124.93 4 1 LYS A 45 ? ? -96.20 30.20 5 1 ASP A 69 ? ? -101.75 40.76 6 2 SER A 12 ? ? 169.37 -34.66 7 2 HIS A 15 ? ? -122.23 -127.09 8 2 ALA A 31 ? ? -67.49 -165.67 9 2 LYS A 45 ? ? -95.17 40.90 10 2 ASP A 69 ? ? -95.74 45.48 11 3 GLN A 3 ? ? 43.31 -164.85 12 3 ASN A 38 ? ? 59.08 -87.73 13 3 LYS A 45 ? ? -92.72 44.96 14 3 ALA A 56 ? ? -129.90 -162.74 15 3 ASP A 69 ? ? -100.47 40.50 16 4 ALA A 31 ? ? -63.82 -173.66 17 4 ASN A 38 ? ? 63.78 -85.75 18 4 LYS A 45 ? ? -92.53 46.92 19 4 ASP A 69 ? ? -99.56 37.46 20 5 SER A 12 ? ? 169.65 -35.18 21 5 ALA A 31 ? ? -61.63 -176.36 22 5 ASN A 38 ? ? 64.57 -85.34 23 5 ASP A 69 ? ? -97.04 41.73 24 6 SER A 12 ? ? 169.76 -34.94 25 6 ASP A 69 ? ? -101.63 41.23 26 7 HIS A 15 ? ? -121.56 -167.49 27 8 HIS A 15 ? ? -110.13 -165.58 28 8 ALA A 31 ? ? -62.10 -174.87 29 8 ASP A 69 ? ? -98.13 38.75 30 9 GLN A 3 ? ? 176.50 167.33 31 9 SER A 12 ? ? 84.44 -46.19 32 9 HIS A 15 ? ? -119.21 -169.54 33 9 LYS A 45 ? ? -95.13 41.79 34 9 ALA A 56 ? ? -123.31 -168.51 35 10 THR A 9 ? ? -150.02 22.63 36 10 ALA A 10 ? ? -63.90 -169.20 37 10 HIS A 15 ? ? -122.24 -125.78 38 10 ASP A 69 ? ? -98.32 34.68 39 11 THR A 9 ? ? -150.02 22.63 40 11 ALA A 10 ? ? -63.90 -169.20 41 11 HIS A 15 ? ? -122.24 -125.78 42 11 ASP A 69 ? ? -98.32 34.68 43 12 GLN A 3 ? ? -177.05 -173.72 44 12 LYS A 4 ? ? -173.59 -171.21 45 12 SER A 12 ? ? 84.64 -51.93 46 12 HIS A 15 ? ? -129.70 -167.59 47 12 ALA A 31 ? ? -64.47 -174.38 48 12 ASP A 69 ? ? -97.71 41.58 49 13 GLN A 3 ? ? -177.10 -172.46 50 13 LYS A 4 ? ? -176.33 -178.36 51 13 HIS A 15 ? ? -124.62 -124.89 52 13 LYS A 45 ? ? -93.22 39.60 53 13 ASP A 69 ? ? -96.67 42.25 54 13 GLU A 84 ? ? -90.89 -60.91 55 14 GLN A 3 ? ? -171.70 -177.75 56 14 SER A 12 ? ? 76.52 -4.87 57 14 HIS A 15 ? ? -123.13 -124.51 58 14 ASN A 38 ? ? 65.01 -85.11 59 14 ASP A 69 ? ? -99.36 37.67 60 15 GLN A 3 ? ? 42.62 -164.13 61 15 LYS A 4 ? ? 177.98 174.15 62 15 SER A 12 ? ? 59.57 16.90 63 15 HIS A 15 ? ? -121.87 -166.16 64 15 ALA A 31 ? ? -62.12 -178.93 65 15 ALA A 68 ? ? -101.28 -63.00 66 15 ASP A 69 ? ? -97.11 44.56 67 16 GLN A 3 ? ? -177.86 -172.89 68 16 LYS A 4 ? ? 179.72 170.23 69 16 SER A 12 ? ? 169.27 -34.99 70 16 HIS A 15 ? ? -129.15 -165.74 71 16 ASP A 69 ? ? -98.38 40.49 72 17 HIS A 15 ? ? -124.75 -164.78 73 17 ALA A 31 ? ? -60.96 -172.27 74 17 ALA A 68 ? ? -91.13 -63.45 75 17 ASP A 69 ? ? -97.09 41.49 76 18 GLN A 3 ? ? 176.50 167.33 77 18 SER A 12 ? ? 84.44 -46.19 78 18 HIS A 15 ? ? -119.21 -169.54 79 18 LYS A 45 ? ? -95.13 41.79 80 18 ALA A 56 ? ? -123.31 -168.51 81 19 SER A 12 ? ? 169.37 -34.66 82 19 HIS A 15 ? ? -122.23 -127.09 83 19 ALA A 31 ? ? -67.49 -165.67 84 19 LYS A 45 ? ? -95.17 40.90 85 19 ASP A 69 ? ? -95.74 45.48 86 20 GLN A 3 ? ? -173.37 -172.55 87 20 SER A 12 ? ? 169.34 -34.94 88 20 HIS A 15 ? ? -123.35 -124.93 89 20 LYS A 45 ? ? -96.20 30.20 90 20 ASP A 69 ? ? -101.75 40.76 91 21 GLN A 3 ? ? -175.94 -172.73 92 21 HIS A 15 ? ? -120.09 -127.57 93 21 ALA A 31 ? ? -65.29 -165.74 94 21 LYS A 45 ? ? -95.02 37.19 95 21 ASP A 69 ? ? -96.06 42.57 96 22 HIS A 15 ? ? -108.00 -141.59 97 22 ALA A 31 ? ? -60.30 -175.11 98 22 ASP A 69 ? ? -99.45 35.40 99 23 GLN A 3 ? ? -179.75 -179.51 100 23 HIS A 15 ? ? -128.61 -167.22 101 23 ASN A 38 ? ? 65.53 -84.98 102 23 LYS A 45 ? ? -96.36 30.46 103 23 ASP A 69 ? ? -98.38 35.52 104 24 GLN A 3 ? ? 179.92 156.73 105 24 HIS A 15 ? ? -110.93 -168.71 106 24 LEU A 44 ? ? -94.76 44.48 107 25 GLN A 3 ? ? -175.94 -172.73 108 25 HIS A 15 ? ? -120.09 -127.57 109 25 ALA A 31 ? ? -65.29 -165.74 110 25 LYS A 45 ? ? -95.02 37.19 111 25 ASP A 69 ? ? -96.06 42.57 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 17 ? ? 0.303 'SIDE CHAIN' 2 2 ARG A 17 ? ? 0.316 'SIDE CHAIN' 3 3 ARG A 17 ? ? 0.204 'SIDE CHAIN' 4 4 ARG A 17 ? ? 0.234 'SIDE CHAIN' 5 5 ARG A 17 ? ? 0.290 'SIDE CHAIN' 6 6 ARG A 17 ? ? 0.309 'SIDE CHAIN' 7 7 ARG A 17 ? ? 0.243 'SIDE CHAIN' 8 8 ARG A 17 ? ? 0.312 'SIDE CHAIN' 9 9 ARG A 17 ? ? 0.264 'SIDE CHAIN' 10 10 ARG A 17 ? ? 0.317 'SIDE CHAIN' 11 11 ARG A 17 ? ? 0.317 'SIDE CHAIN' 12 12 ARG A 17 ? ? 0.309 'SIDE CHAIN' 13 13 ARG A 17 ? ? 0.308 'SIDE CHAIN' 14 14 ARG A 17 ? ? 0.310 'SIDE CHAIN' 15 15 ARG A 17 ? ? 0.279 'SIDE CHAIN' 16 16 ARG A 17 ? ? 0.318 'SIDE CHAIN' 17 17 ARG A 17 ? ? 0.245 'SIDE CHAIN' 18 18 ARG A 17 ? ? 0.264 'SIDE CHAIN' 19 19 ARG A 17 ? ? 0.316 'SIDE CHAIN' 20 20 ARG A 17 ? ? 0.303 'SIDE CHAIN' 21 21 ARG A 17 ? ? 0.315 'SIDE CHAIN' 22 22 ARG A 17 ? ? 0.281 'SIDE CHAIN' 23 23 ARG A 17 ? ? 0.317 'SIDE CHAIN' 24 24 ARG A 17 ? ? 0.234 'SIDE CHAIN' 25 25 ARG A 17 ? ? 0.315 'SIDE CHAIN' #