data_2HIR # _entry.id 2HIR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2HIR WWPDB D_1000178199 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 5HIR _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HIR _pdbx_database_status.recvd_initial_deposition_date 1988-12-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Gronenborn, A.M.' 2 # _citation.id primary _citation.title ;Solution structure of recombinant hirudin and the Lys-47----Glu mutant: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 28 _citation.page_first 2601 _citation.page_last 2617 _citation.year 1989 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 2567183 _citation.pdbx_database_id_DOI 10.1021/bi00432a038 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Folkers, P.J.' 1 primary 'Clore, G.M.' 2 primary 'Driscoll, P.C.' 3 primary 'Dodt, J.' 4 primary 'Kohler, S.' 5 primary 'Gronenborn, A.M.' 6 # _cell.entry_id 2HIR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2HIR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HIRUDIN VARIANT-1' _entity.formula_weight 6973.505 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ _entity_poly.pdbx_seq_one_letter_code_can VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 TYR n 1 4 THR n 1 5 ASP n 1 6 CYS n 1 7 THR n 1 8 GLU n 1 9 SER n 1 10 GLY n 1 11 GLN n 1 12 ASN n 1 13 LEU n 1 14 CYS n 1 15 LEU n 1 16 CYS n 1 17 GLU n 1 18 GLY n 1 19 SER n 1 20 ASN n 1 21 VAL n 1 22 CYS n 1 23 GLY n 1 24 GLN n 1 25 GLY n 1 26 ASN n 1 27 LYS n 1 28 CYS n 1 29 ILE n 1 30 LEU n 1 31 GLY n 1 32 SER n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 LYS n 1 37 ASN n 1 38 GLN n 1 39 CYS n 1 40 VAL n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 THR n 1 46 PRO n 1 47 LYS n 1 48 PRO n 1 49 GLN n 1 50 SER n 1 51 HIS n 1 52 ASN n 1 53 ASP n 1 54 GLY n 1 55 ASP n 1 56 PHE n 1 57 GLU n 1 58 GLU n 1 59 ILE n 1 60 PRO n 1 61 GLU n 1 62 GLU n 1 63 TYR n 1 64 LEU n 1 65 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'medicinal leech' _entity_src_gen.gene_src_genus Hirudo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hirudo medicinalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITH1_HIRME _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01050 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HIR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01050 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 65 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_refine.entry_id 2HIR _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;ONLY RESIDUES 1-49 ARE WELL DEFINED. RESIDUES 50-65 FORM A DISORDERED C-TERMINAL TAIL. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2HIR _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 32 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 2HIR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2HIR _struct.title ;SOLUTION STRUCTURE OF RECOMBINANT HIRUDIN AND THE LYS-47 (RIGHT ARROW) GLU MUTANT. A NUCLEAR MAGNETIC RESONANCE AND HYBRID DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING STUDY ; _struct.pdbx_descriptor 'HIRUDIN (WILD-TYPE) (NMR,32 SIMULATED ANNEALING STRUCTURES)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HIR _struct_keywords.pdbx_keywords 'COAGULATION INHIBITOR' _struct_keywords.text 'COAGULATION INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 6 A CYS 14 1_555 ? ? ? ? ? ? ? 1.989 ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 16 A CYS 28 1_555 ? ? ? ? ? ? ? 2.013 ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 22 A CYS 39 1_555 ? ? ? ? ? ? ? 2.014 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 9 ? GLN A 11 ? SER A 9 GLN A 11 A 2 LYS A 27 ? GLY A 31 ? LYS A 27 GLY A 31 A 3 LYS A 36 ? VAL A 40 ? LYS A 36 VAL A 40 B 1 CYS A 14 ? CYS A 16 ? CYS A 14 CYS A 16 B 2 VAL A 21 ? CYS A 22 ? VAL A 21 CYS A 22 # _database_PDB_matrix.entry_id 2HIR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2HIR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 SER 50 50 ? ? ? A . n A 1 51 HIS 51 51 ? ? ? A . n A 1 52 ASN 52 52 ? ? ? A . n A 1 53 ASP 53 53 ? ? ? A . n A 1 54 GLY 54 54 ? ? ? A . n A 1 55 ASP 55 55 ? ? ? A . n A 1 56 PHE 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 GLU 58 58 ? ? ? A . n A 1 59 ILE 59 59 ? ? ? A . n A 1 60 PRO 60 60 ? ? ? A . n A 1 61 GLU 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n A 1 63 TYR 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 GLN 65 65 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1990-01-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 O A SER 32 ? ? H A GLY 34 ? ? 1.55 2 4 O A LYS 27 ? ? O A VAL 40 ? ? 2.17 3 5 H A GLY 10 ? ? O A CYS 28 ? ? 1.59 4 6 O A SER 32 ? ? H A GLY 34 ? ? 1.53 5 9 HG1 A THR 4 ? ? H A ASP 5 ? ? 1.28 6 9 O A SER 32 ? ? H A GLY 34 ? ? 1.43 7 12 H A GLY 31 ? ? H A LYS 36 ? ? 1.32 8 20 H A THR 7 ? ? HE22 A GLN 11 ? ? 1.21 9 20 HD22 A ASN 12 ? ? H A GLY 44 ? ? 1.27 10 24 H A GLY 10 ? ? O A CYS 28 ? ? 1.55 11 29 H A GLY 31 ? ? H A LYS 36 ? ? 1.34 12 29 O A ASN 12 ? ? H A CYS 14 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 128.17 113.10 15.07 2.50 N 2 2 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.20 113.10 17.10 2.50 N 3 3 N A GLY 31 ? ? CA A GLY 31 ? ? C A GLY 31 ? ? 128.25 113.10 15.15 2.50 N 4 3 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.91 113.10 17.81 2.50 N 5 5 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 132.15 113.10 19.05 2.50 N 6 5 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 129.60 113.10 16.50 2.50 N 7 6 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 128.41 113.10 15.31 2.50 N 8 7 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.01 113.10 16.91 2.50 N 9 7 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 129.74 113.10 16.64 2.50 N 10 9 N A GLY 31 ? ? CA A GLY 31 ? ? C A GLY 31 ? ? 133.68 113.10 20.58 2.50 N 11 10 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.39 113.10 17.29 2.50 N 12 15 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 131.07 113.10 17.97 2.50 N 13 17 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.14 113.10 17.04 2.50 N 14 19 N A GLY 31 ? ? CA A GLY 31 ? ? C A GLY 31 ? ? 129.04 113.10 15.94 2.50 N 15 20 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 131.51 113.10 18.41 2.50 N 16 21 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 131.52 113.10 18.42 2.50 N 17 22 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 129.62 113.10 16.52 2.50 N 18 24 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.98 113.10 17.88 2.50 N 19 26 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 129.94 113.10 16.84 2.50 N 20 30 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 129.60 113.10 16.50 2.50 N 21 31 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 131.51 113.10 18.41 2.50 N 22 31 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 129.10 113.10 16.00 2.50 N 23 32 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 129.77 113.10 16.67 2.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 3 ? ? -120.12 -110.46 2 1 THR A 4 ? ? 173.15 178.71 3 1 CYS A 6 ? ? -40.60 168.06 4 1 THR A 7 ? ? -143.66 11.85 5 1 GLU A 8 ? ? -173.90 125.76 6 1 SER A 9 ? ? -47.10 158.06 7 1 ASN A 12 ? ? -156.49 20.18 8 1 CYS A 16 ? ? -77.68 -82.85 9 1 CYS A 22 ? ? -71.15 -144.67 10 1 GLN A 24 ? ? -19.22 126.00 11 1 ASN A 26 ? ? -110.12 -169.74 12 1 LYS A 36 ? ? -62.79 1.94 13 1 ASN A 37 ? ? 179.60 111.77 14 1 THR A 41 ? ? -31.11 158.69 15 1 PRO A 46 ? ? -68.87 91.68 16 1 LYS A 47 ? ? -33.86 97.72 17 2 TYR A 3 ? ? -114.27 -116.74 18 2 THR A 7 ? ? -142.31 13.32 19 2 SER A 9 ? ? -61.65 -175.62 20 2 GLN A 11 ? ? -59.74 -171.46 21 2 ASN A 12 ? ? -171.77 40.41 22 2 CYS A 22 ? ? -77.93 -132.16 23 2 GLN A 24 ? ? -23.67 142.74 24 2 ASN A 26 ? ? -111.11 -166.89 25 2 SER A 32 ? ? -70.64 -124.96 26 2 ASP A 33 ? ? -57.55 69.47 27 2 GLU A 35 ? ? -100.49 -127.07 28 2 LYS A 36 ? ? -105.18 -118.04 29 2 ASN A 37 ? ? 119.70 36.76 30 2 THR A 41 ? ? -17.83 144.50 31 2 GLU A 43 ? ? -163.73 98.50 32 2 LYS A 47 ? ? -44.71 102.61 33 3 TYR A 3 ? ? -137.34 -111.15 34 3 THR A 4 ? ? 179.16 177.56 35 3 CYS A 6 ? ? -43.01 172.26 36 3 THR A 7 ? ? -146.08 11.06 37 3 ASN A 12 ? ? -167.69 30.66 38 3 LEU A 13 ? ? -146.07 14.56 39 3 CYS A 16 ? ? -75.89 -83.06 40 3 CYS A 22 ? ? -75.27 -165.27 41 3 GLN A 24 ? ? -27.42 148.07 42 3 ASN A 26 ? ? -105.16 -162.28 43 3 SER A 32 ? ? -53.76 -103.38 44 3 ASP A 33 ? ? -48.42 72.05 45 3 GLU A 35 ? ? -86.18 -136.93 46 3 LYS A 36 ? ? -96.12 -124.56 47 3 ASN A 37 ? ? 116.41 36.22 48 3 GLN A 38 ? ? -102.42 -164.33 49 3 THR A 41 ? ? -6.17 141.89 50 3 LYS A 47 ? ? -35.91 95.37 51 4 TYR A 3 ? ? -139.40 -117.88 52 4 THR A 4 ? ? 179.52 177.33 53 4 CYS A 6 ? ? -48.08 155.43 54 4 ASN A 12 ? ? -148.23 -53.29 55 4 CYS A 16 ? ? -75.29 -71.82 56 4 CYS A 22 ? ? -75.93 -152.43 57 4 GLN A 24 ? ? -27.94 147.92 58 4 ASN A 26 ? ? -111.64 -159.60 59 4 SER A 32 ? ? -134.87 -140.86 60 4 ASP A 33 ? ? -66.96 62.42 61 4 GLU A 35 ? ? -84.38 -103.16 62 4 ASN A 37 ? ? -58.68 85.85 63 4 GLU A 43 ? ? -162.99 -150.60 64 4 LYS A 47 ? ? -40.33 100.94 65 5 TYR A 3 ? ? -130.83 -99.48 66 5 THR A 4 ? ? 178.07 -178.92 67 5 THR A 7 ? ? -146.65 14.87 68 5 GLN A 11 ? ? -78.27 -165.98 69 5 ASN A 12 ? ? -164.04 -56.88 70 5 CYS A 16 ? ? -75.44 -84.83 71 5 GLN A 24 ? ? -41.80 3.28 72 5 ASN A 26 ? ? -138.61 -154.53 73 5 LYS A 27 ? ? -163.00 109.30 74 5 LYS A 36 ? ? -68.41 3.11 75 5 ASN A 37 ? ? 175.85 89.00 76 5 CYS A 39 ? ? -158.57 46.17 77 5 THR A 41 ? ? -12.65 139.07 78 5 GLU A 43 ? ? -161.17 28.37 79 5 LYS A 47 ? ? -51.90 109.28 80 6 TYR A 3 ? ? -104.18 -112.57 81 6 CYS A 6 ? ? -46.86 155.37 82 6 THR A 7 ? ? -147.97 16.68 83 6 GLN A 11 ? ? -54.76 -167.04 84 6 ASN A 12 ? ? -176.67 -47.87 85 6 CYS A 16 ? ? -70.82 -77.58 86 6 CYS A 22 ? ? -77.69 -160.56 87 6 GLN A 24 ? ? -30.59 -12.37 88 6 ASN A 26 ? ? -121.97 -156.44 89 6 SER A 32 ? ? -100.06 -141.73 90 6 ASP A 33 ? ? -68.03 59.34 91 6 LYS A 36 ? ? -64.37 0.05 92 6 ASN A 37 ? ? 175.83 113.28 93 6 THR A 41 ? ? -37.55 173.47 94 6 GLU A 43 ? ? -165.01 88.90 95 6 LYS A 47 ? ? -43.99 105.35 96 7 TYR A 3 ? ? -102.93 -116.53 97 7 CYS A 6 ? ? -46.58 169.80 98 7 THR A 7 ? ? -150.08 14.36 99 7 ASN A 12 ? ? -135.64 -93.39 100 7 LEU A 13 ? ? -75.13 40.32 101 7 CYS A 16 ? ? -76.35 -81.71 102 7 GLN A 24 ? ? -59.04 105.49 103 7 ASN A 26 ? ? -118.89 -165.23 104 7 SER A 32 ? ? 167.17 119.33 105 7 ASP A 33 ? ? 53.60 86.47 106 7 ASN A 37 ? ? -159.55 88.80 107 7 THR A 41 ? ? -34.83 168.01 108 7 GLU A 43 ? ? -161.89 119.55 109 7 PRO A 46 ? ? -66.71 95.26 110 7 LYS A 47 ? ? -39.47 99.41 111 8 TYR A 3 ? ? -141.84 -114.01 112 8 THR A 7 ? ? -148.69 18.34 113 8 GLU A 8 ? ? -161.54 109.37 114 8 ASN A 12 ? ? -164.28 -43.08 115 8 CYS A 16 ? ? -67.79 -82.96 116 8 CYS A 22 ? ? -85.40 -140.64 117 8 GLN A 24 ? ? -36.21 152.06 118 8 ASN A 26 ? ? -106.33 -161.83 119 8 LYS A 27 ? ? -160.35 101.96 120 8 SER A 32 ? ? 170.51 99.74 121 8 GLU A 35 ? ? -64.73 -94.54 122 8 LYS A 36 ? ? -90.97 -134.74 123 8 ASN A 37 ? ? 167.71 89.76 124 8 THR A 41 ? ? -27.37 148.73 125 8 GLU A 43 ? ? -98.61 -139.54 126 9 TYR A 3 ? ? -137.99 -112.19 127 9 ASN A 12 ? ? -156.38 -51.13 128 9 CYS A 16 ? ? -74.62 -80.43 129 9 CYS A 22 ? ? -78.47 -146.14 130 9 GLN A 24 ? ? -33.23 154.17 131 9 ASN A 26 ? ? -122.25 -164.16 132 9 LYS A 27 ? ? -162.22 112.35 133 9 SER A 32 ? ? -106.07 -120.80 134 9 ASP A 33 ? ? -66.11 55.05 135 9 GLU A 35 ? ? -170.68 90.30 136 9 LYS A 36 ? ? -100.86 66.52 137 9 THR A 41 ? ? -18.14 146.60 138 9 GLU A 43 ? ? -78.67 -135.22 139 10 TYR A 3 ? ? -106.06 -115.82 140 10 CYS A 6 ? ? -47.80 167.07 141 10 GLU A 8 ? ? -171.16 136.55 142 10 GLN A 11 ? ? -59.79 -174.48 143 10 ASN A 12 ? ? -161.65 21.90 144 10 LEU A 13 ? ? -146.71 25.88 145 10 ASN A 26 ? ? -125.96 -158.24 146 10 ASP A 33 ? ? 35.57 49.91 147 10 LYS A 36 ? ? -66.31 6.18 148 10 CYS A 39 ? ? -116.94 65.10 149 10 THR A 41 ? ? -35.77 167.45 150 10 GLU A 43 ? ? -161.99 116.20 151 11 TYR A 3 ? ? -132.06 -111.84 152 11 ASN A 12 ? ? -151.81 -50.88 153 11 CYS A 16 ? ? -69.94 -93.41 154 11 CYS A 22 ? ? -77.33 -140.18 155 11 GLN A 24 ? ? -34.41 157.17 156 11 ASN A 26 ? ? -104.19 -164.39 157 11 LYS A 27 ? ? -161.67 102.77 158 11 SER A 32 ? ? 175.64 120.66 159 11 ASP A 33 ? ? 52.42 88.39 160 11 ASN A 37 ? ? 175.02 129.90 161 11 THR A 41 ? ? -22.71 155.27 162 11 GLU A 43 ? ? -76.85 -131.15 163 11 PRO A 48 ? ? -56.67 -173.31 164 12 TYR A 3 ? ? -103.82 -113.54 165 12 CYS A 6 ? ? -47.40 171.61 166 12 GLU A 8 ? ? -170.49 139.24 167 12 ASN A 12 ? ? -155.77 -45.00 168 12 CYS A 16 ? ? -64.20 -84.40 169 12 GLU A 17 ? ? -69.88 88.00 170 12 CYS A 22 ? ? -76.29 -129.91 171 12 GLN A 24 ? ? -34.44 149.22 172 12 ASN A 26 ? ? -108.09 -162.90 173 12 SER A 32 ? ? -114.49 -139.49 174 12 GLU A 35 ? ? -177.28 101.13 175 12 GLU A 43 ? ? -162.89 -143.31 176 12 PRO A 46 ? ? -68.68 92.90 177 12 PRO A 48 ? ? -59.48 108.46 178 13 TYR A 3 ? ? -139.68 -121.95 179 13 THR A 4 ? ? 177.99 -177.77 180 13 CYS A 6 ? ? -46.14 169.10 181 13 THR A 7 ? ? -155.27 17.30 182 13 ASN A 12 ? ? -161.30 25.55 183 13 LEU A 13 ? ? -147.61 26.74 184 13 ASN A 26 ? ? -129.98 -163.70 185 13 LYS A 36 ? ? -66.47 8.86 186 13 ASN A 37 ? ? -178.87 69.95 187 13 THR A 41 ? ? -38.80 165.13 188 14 TYR A 3 ? ? -142.59 -113.75 189 14 THR A 7 ? ? -148.13 14.92 190 14 GLN A 11 ? ? -74.71 -164.63 191 14 ASN A 12 ? ? -162.86 -69.36 192 14 CYS A 16 ? ? -69.21 -74.45 193 14 CYS A 22 ? ? -71.85 -142.43 194 14 GLN A 24 ? ? -34.87 155.21 195 14 ASN A 26 ? ? -106.72 -156.55 196 14 ASP A 33 ? ? 37.68 69.95 197 14 ASN A 37 ? ? 179.75 107.48 198 14 THR A 41 ? ? -18.69 151.50 199 15 TYR A 3 ? ? -140.30 -114.73 200 15 SER A 9 ? ? -48.94 154.38 201 15 ASN A 12 ? ? -151.94 -73.51 202 15 LEU A 13 ? ? -74.57 27.85 203 15 CYS A 16 ? ? -69.52 -78.82 204 15 CYS A 22 ? ? -83.17 -138.80 205 15 GLN A 24 ? ? -34.65 159.44 206 15 ASN A 26 ? ? -105.91 -161.22 207 15 LYS A 27 ? ? -160.95 96.42 208 15 SER A 32 ? ? -154.23 -127.64 209 15 ASP A 33 ? ? -58.06 67.47 210 15 GLU A 35 ? ? -78.68 -109.87 211 15 LYS A 36 ? ? -93.10 -141.13 212 15 ASN A 37 ? ? 172.65 123.32 213 15 THR A 41 ? ? -9.41 143.77 214 15 LYS A 47 ? ? -43.78 106.18 215 16 TYR A 3 ? ? -130.23 -118.29 216 16 SER A 9 ? ? -45.14 155.58 217 16 ASN A 12 ? ? -152.20 -48.63 218 16 CYS A 16 ? ? -72.80 -82.24 219 16 CYS A 22 ? ? -73.09 -137.33 220 16 GLN A 24 ? ? -34.36 150.34 221 16 ASN A 26 ? ? -106.50 -161.34 222 16 LYS A 36 ? ? -68.86 6.74 223 16 ASN A 37 ? ? 179.01 112.10 224 16 THR A 41 ? ? -42.58 159.72 225 16 GLU A 43 ? ? -79.15 -148.17 226 17 TYR A 3 ? ? -115.77 -116.46 227 17 CYS A 6 ? ? -49.08 150.77 228 17 THR A 7 ? ? -141.24 12.94 229 17 SER A 9 ? ? -46.77 159.80 230 17 ASN A 12 ? ? -148.29 -64.22 231 17 LEU A 13 ? ? -73.06 22.53 232 17 CYS A 16 ? ? -67.51 -88.63 233 17 CYS A 22 ? ? -74.46 -141.95 234 17 GLN A 24 ? ? -27.45 114.63 235 17 SER A 32 ? ? 138.84 -93.58 236 17 ASP A 33 ? ? -79.20 40.52 237 17 GLU A 35 ? ? -26.25 104.06 238 17 LYS A 36 ? ? -87.79 -141.38 239 17 ASN A 37 ? ? 174.22 114.69 240 17 THR A 41 ? ? -44.83 170.45 241 17 GLU A 43 ? ? -77.14 -144.53 242 17 LYS A 47 ? ? -47.14 105.97 243 17 PRO A 48 ? ? -59.50 104.00 244 18 TYR A 3 ? ? -135.54 -118.19 245 18 THR A 7 ? ? -149.74 12.72 246 18 GLN A 11 ? ? -52.05 179.32 247 18 ASN A 12 ? ? -162.00 28.29 248 18 LEU A 13 ? ? -151.37 28.15 249 18 CYS A 14 ? ? -104.91 -158.48 250 18 CYS A 16 ? ? -72.47 -83.04 251 18 ASN A 37 ? ? -176.13 107.99 252 18 THR A 41 ? ? -19.31 149.06 253 18 LYS A 47 ? ? -42.97 106.98 254 19 TYR A 3 ? ? -147.61 -114.68 255 19 CYS A 6 ? ? -57.94 178.33 256 19 THR A 7 ? ? -151.96 18.32 257 19 ASN A 12 ? ? -153.60 -36.06 258 19 CYS A 16 ? ? -71.02 -83.95 259 19 CYS A 22 ? ? -74.60 -130.43 260 19 GLN A 24 ? ? -35.11 154.38 261 19 ASN A 26 ? ? -96.56 -157.96 262 19 SER A 32 ? ? -23.69 86.85 263 19 GLU A 35 ? ? -75.24 -95.02 264 19 LYS A 36 ? ? -82.25 -131.73 265 19 ASN A 37 ? ? 127.88 37.68 266 19 GLU A 43 ? ? -121.93 -141.32 267 20 TYR A 3 ? ? -131.54 -117.33 268 20 CYS A 6 ? ? -44.91 154.09 269 20 THR A 7 ? ? -149.78 18.80 270 20 SER A 9 ? ? -49.21 154.15 271 20 ASN A 12 ? ? -136.77 -82.04 272 20 LEU A 13 ? ? -73.16 34.64 273 20 CYS A 16 ? ? -73.50 -87.45 274 20 LYS A 36 ? ? -67.27 5.08 275 20 ASN A 37 ? ? 178.36 134.62 276 20 THR A 41 ? ? -25.91 156.29 277 21 TYR A 3 ? ? -108.66 -117.74 278 21 CYS A 6 ? ? -48.85 158.81 279 21 THR A 7 ? ? -145.80 13.74 280 21 SER A 9 ? ? -48.55 156.60 281 21 GLN A 11 ? ? -54.07 -171.75 282 21 ASN A 12 ? ? -172.21 10.53 283 21 CYS A 16 ? ? -77.14 -75.86 284 21 CYS A 22 ? ? -73.74 -140.78 285 21 GLN A 24 ? ? -32.69 145.48 286 21 ASN A 26 ? ? -117.10 -157.91 287 21 LYS A 27 ? ? -160.68 102.85 288 21 SER A 32 ? ? -173.07 89.25 289 21 GLU A 35 ? ? -74.69 -92.48 290 21 LYS A 36 ? ? -70.52 44.85 291 21 ASN A 37 ? ? -45.71 90.21 292 21 THR A 41 ? ? -19.75 155.61 293 22 TYR A 3 ? ? -140.63 -112.93 294 22 GLN A 11 ? ? -61.41 -166.11 295 22 ASN A 12 ? ? -158.48 -68.18 296 22 CYS A 16 ? ? -72.32 -83.41 297 22 CYS A 22 ? ? -78.67 -138.82 298 22 GLN A 24 ? ? -33.88 121.48 299 22 ASN A 26 ? ? -118.22 -167.61 300 22 LYS A 36 ? ? -56.29 -123.72 301 22 GLU A 43 ? ? -157.29 -129.82 302 22 LYS A 47 ? ? -42.35 104.50 303 23 TYR A 3 ? ? -135.54 -118.19 304 23 THR A 7 ? ? -149.74 12.72 305 23 GLN A 11 ? ? -52.05 179.32 306 23 ASN A 12 ? ? -162.00 28.29 307 23 LEU A 13 ? ? -151.37 28.15 308 23 CYS A 14 ? ? -104.91 -158.48 309 23 CYS A 16 ? ? -72.47 -83.04 310 23 ASN A 37 ? ? -176.13 107.99 311 23 THR A 41 ? ? -19.31 149.06 312 23 LYS A 47 ? ? -42.97 106.98 313 24 TYR A 3 ? ? -132.76 -130.28 314 24 CYS A 6 ? ? -43.69 158.16 315 24 SER A 9 ? ? -46.45 153.02 316 24 ASN A 12 ? ? -153.50 -72.46 317 24 CYS A 16 ? ? -70.93 -79.51 318 24 CYS A 22 ? ? -100.00 -146.96 319 24 GLN A 24 ? ? -35.25 160.76 320 24 ASN A 26 ? ? -109.15 -163.43 321 24 LYS A 27 ? ? -160.39 96.75 322 24 SER A 32 ? ? -67.78 -123.12 323 24 ASP A 33 ? ? -56.30 70.36 324 24 GLU A 35 ? ? -96.39 -127.10 325 24 LYS A 36 ? ? -98.31 -118.69 326 24 ASN A 37 ? ? 114.18 40.37 327 24 GLN A 38 ? ? -103.03 -165.28 328 24 THR A 41 ? ? -6.35 144.05 329 24 LYS A 47 ? ? -43.15 105.27 330 24 PRO A 48 ? ? -63.53 -168.63 331 25 TYR A 3 ? ? -130.83 -121.80 332 25 CYS A 6 ? ? -47.65 153.88 333 25 THR A 7 ? ? -148.57 18.03 334 25 ASN A 12 ? ? -148.00 -42.16 335 25 LEU A 13 ? ? -75.76 22.88 336 25 CYS A 16 ? ? -69.89 -77.77 337 25 CYS A 22 ? ? -82.35 -140.20 338 25 GLN A 24 ? ? -33.94 150.78 339 25 ASN A 26 ? ? -114.15 -163.95 340 25 LYS A 36 ? ? -63.95 9.36 341 25 ASN A 37 ? ? 172.18 87.39 342 25 GLU A 43 ? ? -159.46 -140.68 343 26 TYR A 3 ? ? -114.08 -110.25 344 26 THR A 4 ? ? 177.20 179.22 345 26 CYS A 6 ? ? -47.56 160.72 346 26 ASN A 12 ? ? -151.21 21.33 347 26 CYS A 16 ? ? -72.14 -80.77 348 26 CYS A 22 ? ? -103.69 -143.26 349 26 GLN A 24 ? ? -35.30 162.02 350 26 LYS A 27 ? ? -161.35 102.88 351 26 SER A 32 ? ? 168.05 115.64 352 26 ASP A 33 ? ? 53.37 85.38 353 26 LYS A 36 ? ? -48.34 -117.94 354 26 ASN A 37 ? ? -58.85 89.95 355 26 THR A 41 ? ? -9.15 153.10 356 26 GLU A 43 ? ? -76.55 -131.13 357 26 LYS A 47 ? ? -38.63 104.89 358 27 TYR A 3 ? ? -118.40 -96.72 359 27 CYS A 6 ? ? -48.88 160.13 360 27 THR A 7 ? ? -152.80 14.77 361 27 GLU A 8 ? ? -166.20 117.97 362 27 SER A 9 ? ? -45.81 160.99 363 27 GLN A 11 ? ? -67.60 -168.84 364 27 ASN A 12 ? ? -166.00 -28.76 365 27 CYS A 16 ? ? -82.24 -72.68 366 27 CYS A 22 ? ? -72.91 -136.24 367 27 GLN A 24 ? ? -34.76 155.51 368 27 ASN A 26 ? ? -108.00 -162.09 369 27 SER A 32 ? ? -170.36 89.22 370 27 ASP A 33 ? ? 43.76 72.52 371 27 GLU A 35 ? ? -71.74 -104.92 372 27 LYS A 36 ? ? -78.95 45.14 373 27 GLU A 43 ? ? -154.18 -135.16 374 28 TYR A 3 ? ? -106.36 -114.17 375 28 CYS A 6 ? ? -47.35 170.26 376 28 THR A 7 ? ? -144.38 10.23 377 28 SER A 9 ? ? -46.81 163.21 378 28 GLN A 11 ? ? -58.64 -164.58 379 28 ASN A 12 ? ? -145.68 -81.48 380 28 LEU A 13 ? ? -75.32 36.72 381 28 CYS A 16 ? ? -71.59 -78.64 382 28 ASP A 33 ? ? 39.55 50.63 383 28 LYS A 36 ? ? -56.85 -121.28 384 28 THR A 41 ? ? -29.06 155.73 385 28 LYS A 47 ? ? -39.85 101.39 386 28 PRO A 48 ? ? -64.83 -169.20 387 29 TYR A 3 ? ? -110.31 -116.69 388 29 CYS A 6 ? ? -48.81 158.07 389 29 ASN A 12 ? ? -139.83 -80.49 390 29 LEU A 13 ? ? -71.63 41.67 391 29 CYS A 16 ? ? -61.99 -94.48 392 29 SER A 32 ? ? -102.26 -137.96 393 29 ASP A 33 ? ? -48.89 -19.25 394 29 GLU A 35 ? ? -167.53 95.19 395 29 THR A 41 ? ? -32.99 159.18 396 30 TYR A 3 ? ? -145.19 -114.00 397 30 THR A 7 ? ? -145.63 15.36 398 30 GLU A 8 ? ? -162.46 113.67 399 30 SER A 9 ? ? -46.87 155.41 400 30 GLN A 11 ? ? -79.39 -168.52 401 30 ASN A 12 ? ? -130.95 -91.18 402 30 LEU A 13 ? ? -74.35 37.58 403 30 CYS A 16 ? ? -66.97 -85.42 404 30 ASN A 26 ? ? -119.38 -164.45 405 30 SER A 32 ? ? -175.48 100.66 406 30 GLU A 35 ? ? -78.34 -107.45 407 30 ASN A 37 ? ? -54.77 93.42 408 30 THR A 41 ? ? -36.13 165.82 409 30 GLU A 43 ? ? -161.07 115.40 410 30 PRO A 46 ? ? -61.85 96.60 411 30 LYS A 47 ? ? -39.32 104.81 412 31 VAL A 2 ? ? -142.61 16.37 413 31 TYR A 3 ? ? -104.66 -128.40 414 31 CYS A 6 ? ? -44.62 155.44 415 31 THR A 7 ? ? -140.75 11.48 416 31 GLN A 11 ? ? -75.63 -168.65 417 31 ASN A 12 ? ? -151.14 -72.05 418 31 LEU A 13 ? ? -75.73 20.70 419 31 CYS A 16 ? ? -72.38 -81.69 420 31 CYS A 22 ? ? -84.81 -142.37 421 31 GLN A 24 ? ? -31.42 150.90 422 31 LYS A 27 ? ? -161.32 117.10 423 31 SER A 32 ? ? -179.28 106.67 424 31 ASP A 33 ? ? 45.45 85.01 425 31 LYS A 36 ? ? -53.53 -134.73 426 31 ASN A 37 ? ? -64.65 85.99 427 31 THR A 41 ? ? -16.71 141.48 428 31 GLU A 43 ? ? -161.05 100.31 429 31 LYS A 47 ? ? -39.45 103.54 430 31 PRO A 48 ? ? -65.68 -174.24 431 32 TYR A 3 ? ? -114.38 -112.65 432 32 CYS A 6 ? ? -48.76 155.38 433 32 SER A 9 ? ? -42.00 166.22 434 32 ASN A 12 ? ? -154.95 -67.29 435 32 LEU A 13 ? ? -74.07 22.90 436 32 CYS A 16 ? ? -70.39 -83.22 437 32 CYS A 22 ? ? -78.56 -143.33 438 32 GLN A 24 ? ? -35.09 151.06 439 32 ASN A 26 ? ? -111.40 -161.75 440 32 LYS A 27 ? ? -161.92 110.63 441 32 SER A 32 ? ? -168.16 90.47 442 32 GLU A 35 ? ? -61.20 -101.87 443 32 THR A 41 ? ? -16.76 152.93 444 32 GLU A 43 ? ? -160.91 111.51 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 5 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 GLU _pdbx_validate_polymer_linkage.auth_seq_id_1 35 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 LYS _pdbx_validate_polymer_linkage.auth_seq_id_2 36 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.20 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 50 ? A SER 50 2 1 Y 1 A HIS 51 ? A HIS 51 3 1 Y 1 A ASN 52 ? A ASN 52 4 1 Y 1 A ASP 53 ? A ASP 53 5 1 Y 1 A GLY 54 ? A GLY 54 6 1 Y 1 A ASP 55 ? A ASP 55 7 1 Y 1 A PHE 56 ? A PHE 56 8 1 Y 1 A GLU 57 ? A GLU 57 9 1 Y 1 A GLU 58 ? A GLU 58 10 1 Y 1 A ILE 59 ? A ILE 59 11 1 Y 1 A PRO 60 ? A PRO 60 12 1 Y 1 A GLU 61 ? A GLU 61 13 1 Y 1 A GLU 62 ? A GLU 62 14 1 Y 1 A TYR 63 ? A TYR 63 15 1 Y 1 A LEU 64 ? A LEU 64 16 1 Y 1 A GLN 65 ? A GLN 65 17 2 Y 1 A SER 50 ? A SER 50 18 2 Y 1 A HIS 51 ? A HIS 51 19 2 Y 1 A ASN 52 ? A ASN 52 20 2 Y 1 A ASP 53 ? A ASP 53 21 2 Y 1 A GLY 54 ? A GLY 54 22 2 Y 1 A ASP 55 ? A ASP 55 23 2 Y 1 A PHE 56 ? A PHE 56 24 2 Y 1 A GLU 57 ? A GLU 57 25 2 Y 1 A GLU 58 ? A GLU 58 26 2 Y 1 A ILE 59 ? A ILE 59 27 2 Y 1 A PRO 60 ? A PRO 60 28 2 Y 1 A GLU 61 ? A GLU 61 29 2 Y 1 A GLU 62 ? A GLU 62 30 2 Y 1 A TYR 63 ? A TYR 63 31 2 Y 1 A LEU 64 ? A LEU 64 32 2 Y 1 A GLN 65 ? A GLN 65 33 3 Y 1 A SER 50 ? A SER 50 34 3 Y 1 A HIS 51 ? A HIS 51 35 3 Y 1 A ASN 52 ? A ASN 52 36 3 Y 1 A ASP 53 ? A ASP 53 37 3 Y 1 A GLY 54 ? A GLY 54 38 3 Y 1 A ASP 55 ? A ASP 55 39 3 Y 1 A PHE 56 ? A PHE 56 40 3 Y 1 A GLU 57 ? A GLU 57 41 3 Y 1 A GLU 58 ? A GLU 58 42 3 Y 1 A ILE 59 ? A ILE 59 43 3 Y 1 A PRO 60 ? A PRO 60 44 3 Y 1 A GLU 61 ? A GLU 61 45 3 Y 1 A GLU 62 ? A GLU 62 46 3 Y 1 A TYR 63 ? A TYR 63 47 3 Y 1 A LEU 64 ? A LEU 64 48 3 Y 1 A GLN 65 ? A GLN 65 49 4 Y 1 A SER 50 ? A SER 50 50 4 Y 1 A HIS 51 ? A HIS 51 51 4 Y 1 A ASN 52 ? A ASN 52 52 4 Y 1 A ASP 53 ? A ASP 53 53 4 Y 1 A GLY 54 ? A GLY 54 54 4 Y 1 A ASP 55 ? A ASP 55 55 4 Y 1 A PHE 56 ? A PHE 56 56 4 Y 1 A GLU 57 ? A GLU 57 57 4 Y 1 A GLU 58 ? A GLU 58 58 4 Y 1 A ILE 59 ? A ILE 59 59 4 Y 1 A PRO 60 ? A PRO 60 60 4 Y 1 A GLU 61 ? A GLU 61 61 4 Y 1 A GLU 62 ? A GLU 62 62 4 Y 1 A TYR 63 ? A TYR 63 63 4 Y 1 A LEU 64 ? A LEU 64 64 4 Y 1 A GLN 65 ? A GLN 65 65 5 Y 1 A SER 50 ? A SER 50 66 5 Y 1 A HIS 51 ? A HIS 51 67 5 Y 1 A ASN 52 ? A ASN 52 68 5 Y 1 A ASP 53 ? A ASP 53 69 5 Y 1 A GLY 54 ? A GLY 54 70 5 Y 1 A ASP 55 ? A ASP 55 71 5 Y 1 A PHE 56 ? A PHE 56 72 5 Y 1 A GLU 57 ? A GLU 57 73 5 Y 1 A GLU 58 ? A GLU 58 74 5 Y 1 A ILE 59 ? A ILE 59 75 5 Y 1 A PRO 60 ? A PRO 60 76 5 Y 1 A GLU 61 ? A GLU 61 77 5 Y 1 A GLU 62 ? A GLU 62 78 5 Y 1 A TYR 63 ? A TYR 63 79 5 Y 1 A LEU 64 ? A LEU 64 80 5 Y 1 A GLN 65 ? A GLN 65 81 6 Y 1 A SER 50 ? A SER 50 82 6 Y 1 A HIS 51 ? A HIS 51 83 6 Y 1 A ASN 52 ? A ASN 52 84 6 Y 1 A ASP 53 ? A ASP 53 85 6 Y 1 A GLY 54 ? A GLY 54 86 6 Y 1 A ASP 55 ? A ASP 55 87 6 Y 1 A PHE 56 ? A PHE 56 88 6 Y 1 A GLU 57 ? A GLU 57 89 6 Y 1 A GLU 58 ? A GLU 58 90 6 Y 1 A ILE 59 ? A ILE 59 91 6 Y 1 A PRO 60 ? A PRO 60 92 6 Y 1 A GLU 61 ? A GLU 61 93 6 Y 1 A GLU 62 ? A GLU 62 94 6 Y 1 A TYR 63 ? A TYR 63 95 6 Y 1 A LEU 64 ? A LEU 64 96 6 Y 1 A GLN 65 ? A GLN 65 97 7 Y 1 A SER 50 ? A SER 50 98 7 Y 1 A HIS 51 ? A HIS 51 99 7 Y 1 A ASN 52 ? A ASN 52 100 7 Y 1 A ASP 53 ? A ASP 53 101 7 Y 1 A GLY 54 ? A GLY 54 102 7 Y 1 A ASP 55 ? A ASP 55 103 7 Y 1 A PHE 56 ? A PHE 56 104 7 Y 1 A GLU 57 ? A GLU 57 105 7 Y 1 A GLU 58 ? A GLU 58 106 7 Y 1 A ILE 59 ? A ILE 59 107 7 Y 1 A PRO 60 ? A PRO 60 108 7 Y 1 A GLU 61 ? A GLU 61 109 7 Y 1 A GLU 62 ? A GLU 62 110 7 Y 1 A TYR 63 ? A TYR 63 111 7 Y 1 A LEU 64 ? A LEU 64 112 7 Y 1 A GLN 65 ? A GLN 65 113 8 Y 1 A SER 50 ? A SER 50 114 8 Y 1 A HIS 51 ? A HIS 51 115 8 Y 1 A ASN 52 ? A ASN 52 116 8 Y 1 A ASP 53 ? A ASP 53 117 8 Y 1 A GLY 54 ? A GLY 54 118 8 Y 1 A ASP 55 ? A ASP 55 119 8 Y 1 A PHE 56 ? A PHE 56 120 8 Y 1 A GLU 57 ? A GLU 57 121 8 Y 1 A GLU 58 ? A GLU 58 122 8 Y 1 A ILE 59 ? A ILE 59 123 8 Y 1 A PRO 60 ? A PRO 60 124 8 Y 1 A GLU 61 ? A GLU 61 125 8 Y 1 A GLU 62 ? A GLU 62 126 8 Y 1 A TYR 63 ? A TYR 63 127 8 Y 1 A LEU 64 ? A LEU 64 128 8 Y 1 A GLN 65 ? A GLN 65 129 9 Y 1 A SER 50 ? A SER 50 130 9 Y 1 A HIS 51 ? A HIS 51 131 9 Y 1 A ASN 52 ? A ASN 52 132 9 Y 1 A ASP 53 ? A ASP 53 133 9 Y 1 A GLY 54 ? A GLY 54 134 9 Y 1 A ASP 55 ? A ASP 55 135 9 Y 1 A PHE 56 ? A PHE 56 136 9 Y 1 A GLU 57 ? A GLU 57 137 9 Y 1 A GLU 58 ? A GLU 58 138 9 Y 1 A ILE 59 ? A ILE 59 139 9 Y 1 A PRO 60 ? A PRO 60 140 9 Y 1 A GLU 61 ? A GLU 61 141 9 Y 1 A GLU 62 ? A GLU 62 142 9 Y 1 A TYR 63 ? A TYR 63 143 9 Y 1 A LEU 64 ? A LEU 64 144 9 Y 1 A GLN 65 ? A GLN 65 145 10 Y 1 A SER 50 ? A SER 50 146 10 Y 1 A HIS 51 ? A HIS 51 147 10 Y 1 A ASN 52 ? A ASN 52 148 10 Y 1 A ASP 53 ? A ASP 53 149 10 Y 1 A GLY 54 ? A GLY 54 150 10 Y 1 A ASP 55 ? A ASP 55 151 10 Y 1 A PHE 56 ? A PHE 56 152 10 Y 1 A GLU 57 ? A GLU 57 153 10 Y 1 A GLU 58 ? A GLU 58 154 10 Y 1 A ILE 59 ? A ILE 59 155 10 Y 1 A PRO 60 ? A PRO 60 156 10 Y 1 A GLU 61 ? A GLU 61 157 10 Y 1 A GLU 62 ? A GLU 62 158 10 Y 1 A TYR 63 ? A TYR 63 159 10 Y 1 A LEU 64 ? A LEU 64 160 10 Y 1 A GLN 65 ? A GLN 65 161 11 Y 1 A SER 50 ? A SER 50 162 11 Y 1 A HIS 51 ? A HIS 51 163 11 Y 1 A ASN 52 ? A ASN 52 164 11 Y 1 A ASP 53 ? A ASP 53 165 11 Y 1 A GLY 54 ? A GLY 54 166 11 Y 1 A ASP 55 ? A ASP 55 167 11 Y 1 A PHE 56 ? A PHE 56 168 11 Y 1 A GLU 57 ? A GLU 57 169 11 Y 1 A GLU 58 ? A GLU 58 170 11 Y 1 A ILE 59 ? A ILE 59 171 11 Y 1 A PRO 60 ? A PRO 60 172 11 Y 1 A GLU 61 ? A GLU 61 173 11 Y 1 A GLU 62 ? A GLU 62 174 11 Y 1 A TYR 63 ? A TYR 63 175 11 Y 1 A LEU 64 ? A LEU 64 176 11 Y 1 A GLN 65 ? A GLN 65 177 12 Y 1 A SER 50 ? A SER 50 178 12 Y 1 A HIS 51 ? A HIS 51 179 12 Y 1 A ASN 52 ? A ASN 52 180 12 Y 1 A ASP 53 ? A ASP 53 181 12 Y 1 A GLY 54 ? A GLY 54 182 12 Y 1 A ASP 55 ? A ASP 55 183 12 Y 1 A PHE 56 ? A PHE 56 184 12 Y 1 A GLU 57 ? A GLU 57 185 12 Y 1 A GLU 58 ? A GLU 58 186 12 Y 1 A ILE 59 ? A ILE 59 187 12 Y 1 A PRO 60 ? A PRO 60 188 12 Y 1 A GLU 61 ? A GLU 61 189 12 Y 1 A GLU 62 ? A GLU 62 190 12 Y 1 A TYR 63 ? A TYR 63 191 12 Y 1 A LEU 64 ? A LEU 64 192 12 Y 1 A GLN 65 ? A GLN 65 193 13 Y 1 A SER 50 ? A SER 50 194 13 Y 1 A HIS 51 ? A HIS 51 195 13 Y 1 A ASN 52 ? A ASN 52 196 13 Y 1 A ASP 53 ? A ASP 53 197 13 Y 1 A GLY 54 ? A GLY 54 198 13 Y 1 A ASP 55 ? A ASP 55 199 13 Y 1 A PHE 56 ? A PHE 56 200 13 Y 1 A GLU 57 ? A GLU 57 201 13 Y 1 A GLU 58 ? A GLU 58 202 13 Y 1 A ILE 59 ? A ILE 59 203 13 Y 1 A PRO 60 ? A PRO 60 204 13 Y 1 A GLU 61 ? A GLU 61 205 13 Y 1 A GLU 62 ? A GLU 62 206 13 Y 1 A TYR 63 ? A TYR 63 207 13 Y 1 A LEU 64 ? A LEU 64 208 13 Y 1 A GLN 65 ? A GLN 65 209 14 Y 1 A SER 50 ? A SER 50 210 14 Y 1 A HIS 51 ? A HIS 51 211 14 Y 1 A ASN 52 ? A ASN 52 212 14 Y 1 A ASP 53 ? A ASP 53 213 14 Y 1 A GLY 54 ? A GLY 54 214 14 Y 1 A ASP 55 ? A ASP 55 215 14 Y 1 A PHE 56 ? A PHE 56 216 14 Y 1 A GLU 57 ? A GLU 57 217 14 Y 1 A GLU 58 ? A GLU 58 218 14 Y 1 A ILE 59 ? A ILE 59 219 14 Y 1 A PRO 60 ? A PRO 60 220 14 Y 1 A GLU 61 ? A GLU 61 221 14 Y 1 A GLU 62 ? A GLU 62 222 14 Y 1 A TYR 63 ? A TYR 63 223 14 Y 1 A LEU 64 ? A LEU 64 224 14 Y 1 A GLN 65 ? A GLN 65 225 15 Y 1 A SER 50 ? A SER 50 226 15 Y 1 A HIS 51 ? A HIS 51 227 15 Y 1 A ASN 52 ? A ASN 52 228 15 Y 1 A ASP 53 ? A ASP 53 229 15 Y 1 A GLY 54 ? A GLY 54 230 15 Y 1 A ASP 55 ? A ASP 55 231 15 Y 1 A PHE 56 ? A PHE 56 232 15 Y 1 A GLU 57 ? A GLU 57 233 15 Y 1 A GLU 58 ? A GLU 58 234 15 Y 1 A ILE 59 ? A ILE 59 235 15 Y 1 A PRO 60 ? A PRO 60 236 15 Y 1 A GLU 61 ? A GLU 61 237 15 Y 1 A GLU 62 ? A GLU 62 238 15 Y 1 A TYR 63 ? A TYR 63 239 15 Y 1 A LEU 64 ? A LEU 64 240 15 Y 1 A GLN 65 ? A GLN 65 241 16 Y 1 A SER 50 ? A SER 50 242 16 Y 1 A HIS 51 ? A HIS 51 243 16 Y 1 A ASN 52 ? A ASN 52 244 16 Y 1 A ASP 53 ? A ASP 53 245 16 Y 1 A GLY 54 ? A GLY 54 246 16 Y 1 A ASP 55 ? A ASP 55 247 16 Y 1 A PHE 56 ? A PHE 56 248 16 Y 1 A GLU 57 ? A GLU 57 249 16 Y 1 A GLU 58 ? A GLU 58 250 16 Y 1 A ILE 59 ? A ILE 59 251 16 Y 1 A PRO 60 ? A PRO 60 252 16 Y 1 A GLU 61 ? A GLU 61 253 16 Y 1 A GLU 62 ? A GLU 62 254 16 Y 1 A TYR 63 ? A TYR 63 255 16 Y 1 A LEU 64 ? A LEU 64 256 16 Y 1 A GLN 65 ? A GLN 65 257 17 Y 1 A SER 50 ? A SER 50 258 17 Y 1 A HIS 51 ? A HIS 51 259 17 Y 1 A ASN 52 ? A ASN 52 260 17 Y 1 A ASP 53 ? A ASP 53 261 17 Y 1 A GLY 54 ? A GLY 54 262 17 Y 1 A ASP 55 ? A ASP 55 263 17 Y 1 A PHE 56 ? A PHE 56 264 17 Y 1 A GLU 57 ? A GLU 57 265 17 Y 1 A GLU 58 ? A GLU 58 266 17 Y 1 A ILE 59 ? A ILE 59 267 17 Y 1 A PRO 60 ? A PRO 60 268 17 Y 1 A GLU 61 ? A GLU 61 269 17 Y 1 A GLU 62 ? A GLU 62 270 17 Y 1 A TYR 63 ? A TYR 63 271 17 Y 1 A LEU 64 ? A LEU 64 272 17 Y 1 A GLN 65 ? A GLN 65 273 18 Y 1 A SER 50 ? A SER 50 274 18 Y 1 A HIS 51 ? A HIS 51 275 18 Y 1 A ASN 52 ? A ASN 52 276 18 Y 1 A ASP 53 ? A ASP 53 277 18 Y 1 A GLY 54 ? A GLY 54 278 18 Y 1 A ASP 55 ? A ASP 55 279 18 Y 1 A PHE 56 ? A PHE 56 280 18 Y 1 A GLU 57 ? A GLU 57 281 18 Y 1 A GLU 58 ? A GLU 58 282 18 Y 1 A ILE 59 ? A ILE 59 283 18 Y 1 A PRO 60 ? A PRO 60 284 18 Y 1 A GLU 61 ? A GLU 61 285 18 Y 1 A GLU 62 ? A GLU 62 286 18 Y 1 A TYR 63 ? A TYR 63 287 18 Y 1 A LEU 64 ? A LEU 64 288 18 Y 1 A GLN 65 ? A GLN 65 289 19 Y 1 A SER 50 ? A SER 50 290 19 Y 1 A HIS 51 ? A HIS 51 291 19 Y 1 A ASN 52 ? A ASN 52 292 19 Y 1 A ASP 53 ? A ASP 53 293 19 Y 1 A GLY 54 ? A GLY 54 294 19 Y 1 A ASP 55 ? A ASP 55 295 19 Y 1 A PHE 56 ? A PHE 56 296 19 Y 1 A GLU 57 ? A GLU 57 297 19 Y 1 A GLU 58 ? A GLU 58 298 19 Y 1 A ILE 59 ? A ILE 59 299 19 Y 1 A PRO 60 ? A PRO 60 300 19 Y 1 A GLU 61 ? A GLU 61 301 19 Y 1 A GLU 62 ? A GLU 62 302 19 Y 1 A TYR 63 ? A TYR 63 303 19 Y 1 A LEU 64 ? A LEU 64 304 19 Y 1 A GLN 65 ? A GLN 65 305 20 Y 1 A SER 50 ? A SER 50 306 20 Y 1 A HIS 51 ? A HIS 51 307 20 Y 1 A ASN 52 ? A ASN 52 308 20 Y 1 A ASP 53 ? A ASP 53 309 20 Y 1 A GLY 54 ? A GLY 54 310 20 Y 1 A ASP 55 ? A ASP 55 311 20 Y 1 A PHE 56 ? A PHE 56 312 20 Y 1 A GLU 57 ? A GLU 57 313 20 Y 1 A GLU 58 ? A GLU 58 314 20 Y 1 A ILE 59 ? A ILE 59 315 20 Y 1 A PRO 60 ? A PRO 60 316 20 Y 1 A GLU 61 ? A GLU 61 317 20 Y 1 A GLU 62 ? A GLU 62 318 20 Y 1 A TYR 63 ? A TYR 63 319 20 Y 1 A LEU 64 ? A LEU 64 320 20 Y 1 A GLN 65 ? A GLN 65 321 21 Y 1 A SER 50 ? A SER 50 322 21 Y 1 A HIS 51 ? A HIS 51 323 21 Y 1 A ASN 52 ? A ASN 52 324 21 Y 1 A ASP 53 ? A ASP 53 325 21 Y 1 A GLY 54 ? A GLY 54 326 21 Y 1 A ASP 55 ? A ASP 55 327 21 Y 1 A PHE 56 ? A PHE 56 328 21 Y 1 A GLU 57 ? A GLU 57 329 21 Y 1 A GLU 58 ? A GLU 58 330 21 Y 1 A ILE 59 ? A ILE 59 331 21 Y 1 A PRO 60 ? A PRO 60 332 21 Y 1 A GLU 61 ? A GLU 61 333 21 Y 1 A GLU 62 ? A GLU 62 334 21 Y 1 A TYR 63 ? A TYR 63 335 21 Y 1 A LEU 64 ? A LEU 64 336 21 Y 1 A GLN 65 ? A GLN 65 337 22 Y 1 A SER 50 ? A SER 50 338 22 Y 1 A HIS 51 ? A HIS 51 339 22 Y 1 A ASN 52 ? A ASN 52 340 22 Y 1 A ASP 53 ? A ASP 53 341 22 Y 1 A GLY 54 ? A GLY 54 342 22 Y 1 A ASP 55 ? A ASP 55 343 22 Y 1 A PHE 56 ? A PHE 56 344 22 Y 1 A GLU 57 ? A GLU 57 345 22 Y 1 A GLU 58 ? A GLU 58 346 22 Y 1 A ILE 59 ? A ILE 59 347 22 Y 1 A PRO 60 ? A PRO 60 348 22 Y 1 A GLU 61 ? A GLU 61 349 22 Y 1 A GLU 62 ? A GLU 62 350 22 Y 1 A TYR 63 ? A TYR 63 351 22 Y 1 A LEU 64 ? A LEU 64 352 22 Y 1 A GLN 65 ? A GLN 65 353 23 Y 1 A SER 50 ? A SER 50 354 23 Y 1 A HIS 51 ? A HIS 51 355 23 Y 1 A ASN 52 ? A ASN 52 356 23 Y 1 A ASP 53 ? A ASP 53 357 23 Y 1 A GLY 54 ? A GLY 54 358 23 Y 1 A ASP 55 ? A ASP 55 359 23 Y 1 A PHE 56 ? A PHE 56 360 23 Y 1 A GLU 57 ? A GLU 57 361 23 Y 1 A GLU 58 ? A GLU 58 362 23 Y 1 A ILE 59 ? A ILE 59 363 23 Y 1 A PRO 60 ? A PRO 60 364 23 Y 1 A GLU 61 ? A GLU 61 365 23 Y 1 A GLU 62 ? A GLU 62 366 23 Y 1 A TYR 63 ? A TYR 63 367 23 Y 1 A LEU 64 ? A LEU 64 368 23 Y 1 A GLN 65 ? A GLN 65 369 24 Y 1 A SER 50 ? A SER 50 370 24 Y 1 A HIS 51 ? A HIS 51 371 24 Y 1 A ASN 52 ? A ASN 52 372 24 Y 1 A ASP 53 ? A ASP 53 373 24 Y 1 A GLY 54 ? A GLY 54 374 24 Y 1 A ASP 55 ? A ASP 55 375 24 Y 1 A PHE 56 ? A PHE 56 376 24 Y 1 A GLU 57 ? A GLU 57 377 24 Y 1 A GLU 58 ? A GLU 58 378 24 Y 1 A ILE 59 ? A ILE 59 379 24 Y 1 A PRO 60 ? A PRO 60 380 24 Y 1 A GLU 61 ? A GLU 61 381 24 Y 1 A GLU 62 ? A GLU 62 382 24 Y 1 A TYR 63 ? A TYR 63 383 24 Y 1 A LEU 64 ? A LEU 64 384 24 Y 1 A GLN 65 ? A GLN 65 385 25 Y 1 A SER 50 ? A SER 50 386 25 Y 1 A HIS 51 ? A HIS 51 387 25 Y 1 A ASN 52 ? A ASN 52 388 25 Y 1 A ASP 53 ? A ASP 53 389 25 Y 1 A GLY 54 ? A GLY 54 390 25 Y 1 A ASP 55 ? A ASP 55 391 25 Y 1 A PHE 56 ? A PHE 56 392 25 Y 1 A GLU 57 ? A GLU 57 393 25 Y 1 A GLU 58 ? A GLU 58 394 25 Y 1 A ILE 59 ? A ILE 59 395 25 Y 1 A PRO 60 ? A PRO 60 396 25 Y 1 A GLU 61 ? A GLU 61 397 25 Y 1 A GLU 62 ? A GLU 62 398 25 Y 1 A TYR 63 ? A TYR 63 399 25 Y 1 A LEU 64 ? A LEU 64 400 25 Y 1 A GLN 65 ? A GLN 65 401 26 Y 1 A SER 50 ? A SER 50 402 26 Y 1 A HIS 51 ? A HIS 51 403 26 Y 1 A ASN 52 ? A ASN 52 404 26 Y 1 A ASP 53 ? A ASP 53 405 26 Y 1 A GLY 54 ? A GLY 54 406 26 Y 1 A ASP 55 ? A ASP 55 407 26 Y 1 A PHE 56 ? A PHE 56 408 26 Y 1 A GLU 57 ? A GLU 57 409 26 Y 1 A GLU 58 ? A GLU 58 410 26 Y 1 A ILE 59 ? A ILE 59 411 26 Y 1 A PRO 60 ? A PRO 60 412 26 Y 1 A GLU 61 ? A GLU 61 413 26 Y 1 A GLU 62 ? A GLU 62 414 26 Y 1 A TYR 63 ? A TYR 63 415 26 Y 1 A LEU 64 ? A LEU 64 416 26 Y 1 A GLN 65 ? A GLN 65 417 27 Y 1 A SER 50 ? A SER 50 418 27 Y 1 A HIS 51 ? A HIS 51 419 27 Y 1 A ASN 52 ? A ASN 52 420 27 Y 1 A ASP 53 ? A ASP 53 421 27 Y 1 A GLY 54 ? A GLY 54 422 27 Y 1 A ASP 55 ? A ASP 55 423 27 Y 1 A PHE 56 ? A PHE 56 424 27 Y 1 A GLU 57 ? A GLU 57 425 27 Y 1 A GLU 58 ? A GLU 58 426 27 Y 1 A ILE 59 ? A ILE 59 427 27 Y 1 A PRO 60 ? A PRO 60 428 27 Y 1 A GLU 61 ? A GLU 61 429 27 Y 1 A GLU 62 ? A GLU 62 430 27 Y 1 A TYR 63 ? A TYR 63 431 27 Y 1 A LEU 64 ? A LEU 64 432 27 Y 1 A GLN 65 ? A GLN 65 433 28 Y 1 A SER 50 ? A SER 50 434 28 Y 1 A HIS 51 ? A HIS 51 435 28 Y 1 A ASN 52 ? A ASN 52 436 28 Y 1 A ASP 53 ? A ASP 53 437 28 Y 1 A GLY 54 ? A GLY 54 438 28 Y 1 A ASP 55 ? A ASP 55 439 28 Y 1 A PHE 56 ? A PHE 56 440 28 Y 1 A GLU 57 ? A GLU 57 441 28 Y 1 A GLU 58 ? A GLU 58 442 28 Y 1 A ILE 59 ? A ILE 59 443 28 Y 1 A PRO 60 ? A PRO 60 444 28 Y 1 A GLU 61 ? A GLU 61 445 28 Y 1 A GLU 62 ? A GLU 62 446 28 Y 1 A TYR 63 ? A TYR 63 447 28 Y 1 A LEU 64 ? A LEU 64 448 28 Y 1 A GLN 65 ? A GLN 65 449 29 Y 1 A SER 50 ? A SER 50 450 29 Y 1 A HIS 51 ? A HIS 51 451 29 Y 1 A ASN 52 ? A ASN 52 452 29 Y 1 A ASP 53 ? A ASP 53 453 29 Y 1 A GLY 54 ? A GLY 54 454 29 Y 1 A ASP 55 ? A ASP 55 455 29 Y 1 A PHE 56 ? A PHE 56 456 29 Y 1 A GLU 57 ? A GLU 57 457 29 Y 1 A GLU 58 ? A GLU 58 458 29 Y 1 A ILE 59 ? A ILE 59 459 29 Y 1 A PRO 60 ? A PRO 60 460 29 Y 1 A GLU 61 ? A GLU 61 461 29 Y 1 A GLU 62 ? A GLU 62 462 29 Y 1 A TYR 63 ? A TYR 63 463 29 Y 1 A LEU 64 ? A LEU 64 464 29 Y 1 A GLN 65 ? A GLN 65 465 30 Y 1 A SER 50 ? A SER 50 466 30 Y 1 A HIS 51 ? A HIS 51 467 30 Y 1 A ASN 52 ? A ASN 52 468 30 Y 1 A ASP 53 ? A ASP 53 469 30 Y 1 A GLY 54 ? A GLY 54 470 30 Y 1 A ASP 55 ? A ASP 55 471 30 Y 1 A PHE 56 ? A PHE 56 472 30 Y 1 A GLU 57 ? A GLU 57 473 30 Y 1 A GLU 58 ? A GLU 58 474 30 Y 1 A ILE 59 ? A ILE 59 475 30 Y 1 A PRO 60 ? A PRO 60 476 30 Y 1 A GLU 61 ? A GLU 61 477 30 Y 1 A GLU 62 ? A GLU 62 478 30 Y 1 A TYR 63 ? A TYR 63 479 30 Y 1 A LEU 64 ? A LEU 64 480 30 Y 1 A GLN 65 ? A GLN 65 481 31 Y 1 A SER 50 ? A SER 50 482 31 Y 1 A HIS 51 ? A HIS 51 483 31 Y 1 A ASN 52 ? A ASN 52 484 31 Y 1 A ASP 53 ? A ASP 53 485 31 Y 1 A GLY 54 ? A GLY 54 486 31 Y 1 A ASP 55 ? A ASP 55 487 31 Y 1 A PHE 56 ? A PHE 56 488 31 Y 1 A GLU 57 ? A GLU 57 489 31 Y 1 A GLU 58 ? A GLU 58 490 31 Y 1 A ILE 59 ? A ILE 59 491 31 Y 1 A PRO 60 ? A PRO 60 492 31 Y 1 A GLU 61 ? A GLU 61 493 31 Y 1 A GLU 62 ? A GLU 62 494 31 Y 1 A TYR 63 ? A TYR 63 495 31 Y 1 A LEU 64 ? A LEU 64 496 31 Y 1 A GLN 65 ? A GLN 65 497 32 Y 1 A SER 50 ? A SER 50 498 32 Y 1 A HIS 51 ? A HIS 51 499 32 Y 1 A ASN 52 ? A ASN 52 500 32 Y 1 A ASP 53 ? A ASP 53 501 32 Y 1 A GLY 54 ? A GLY 54 502 32 Y 1 A ASP 55 ? A ASP 55 503 32 Y 1 A PHE 56 ? A PHE 56 504 32 Y 1 A GLU 57 ? A GLU 57 505 32 Y 1 A GLU 58 ? A GLU 58 506 32 Y 1 A ILE 59 ? A ILE 59 507 32 Y 1 A PRO 60 ? A PRO 60 508 32 Y 1 A GLU 61 ? A GLU 61 509 32 Y 1 A GLU 62 ? A GLU 62 510 32 Y 1 A TYR 63 ? A TYR 63 511 32 Y 1 A LEU 64 ? A LEU 64 512 32 Y 1 A GLN 65 ? A GLN 65 #