data_2HLG # _entry.id 2HLG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HLG pdb_00002hlg 10.2210/pdb2hlg/pdb RCSB RCSB038481 ? ? WWPDB D_1000038481 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HLG _pdbx_database_status.recvd_initial_deposition_date 2006-07-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Uribe, M.I.C.' 1 'Mendez, B.L.' 2 'Vicinay, F.J.C.' 3 'Barbero, J.J.' 4 # _citation.id primary _citation.title 'NMR solution structure of a new tomato peptide' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Uribe, M.I.C.' 1 ? primary 'Mendez, B.L.' 2 ? primary 'Vicinay, F.J.C.' 3 ? primary 'Barbero, J.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Fruit-specific protein' _entity.formula_weight 4379.002 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LCNEPCSSNSDCIGITLCQFCKEKTDQYGLTYRTCNLLP _entity_poly.pdbx_seq_one_letter_code_can LCNEPCSSNSDCIGITLCQFCKEKTDQYGLTYRTCNLLP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 CYS n 1 3 ASN n 1 4 GLU n 1 5 PRO n 1 6 CYS n 1 7 SER n 1 8 SER n 1 9 ASN n 1 10 SER n 1 11 ASP n 1 12 CYS n 1 13 ILE n 1 14 GLY n 1 15 ILE n 1 16 THR n 1 17 LEU n 1 18 CYS n 1 19 GLN n 1 20 PHE n 1 21 CYS n 1 22 LYS n 1 23 GLU n 1 24 LYS n 1 25 THR n 1 26 ASP n 1 27 GLN n 1 28 TYR n 1 29 GLY n 1 30 LEU n 1 31 THR n 1 32 TYR n 1 33 ARG n 1 34 THR n 1 35 CYS n 1 36 ASN n 1 37 LEU n 1 38 LEU n 1 39 PRO n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name Fruit _entity_src_nat.pdbx_organism_scientific 'Lycopersicon esculentum' _entity_src_nat.pdbx_ncbi_taxonomy_id ? _entity_src_nat.genus ? _entity_src_nat.species Tomato _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FSPM_LYCES _struct_ref.pdbx_db_accession P14903 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LCNEPCSSNSDCIGITLCQFCKEKTDQYGLTYRTCNLLP _struct_ref.pdbx_align_begin 58 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HLG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P14903 _struct_ref_seq.db_align_beg 58 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D TOCSY' 1 2 1 '2D NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM tomato peptide; 0.4% of solution H2O/10% HCl; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 500 ? 2 AVANCE Bruker 800 ? # _pdbx_nmr_refine.entry_id 2HLG _pdbx_nmr_refine.method 'torsion angle dynamics and energy minimization in explicit solvent' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2HLG _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2HLG _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CYANA '2. 1' 'P. Guntert et. al.' 1 'structure solution' Amber 8.0 PEARLMAN,CASE,CALDWELL,ROSS,CHEATHAM,FERGUSON,SEIBEL,SINGH,WEINER,KOLLMAN 2 refinement Amber 8.0 PEARLMAN,CASE,CALDWELL,ROSS,CHEATHAM,FERGUSON,SEIBEL,SINGH,WEINER,KOLLMAN 3 # _exptl.entry_id 2HLG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2HLG _struct.title 'NMR solution structure of a new tomato peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HLG _struct_keywords.pdbx_keywords 'PLANT PROTEIN' _struct_keywords.text 'beta antiparallel, PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 9 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 13 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 9 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 13 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 2 A CYS 18 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf2 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 6 A CYS 21 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 12 A CYS 35 1_555 ? ? ? ? ? ? ? 2.036 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 20 ? THR A 25 ? PHE A 20 THR A 25 A 2 THR A 31 ? ASN A 36 ? THR A 31 ASN A 36 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 32 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 32 # _database_PDB_matrix.entry_id 2HLG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2HLG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PRO 39 39 39 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 12 HG1 A THR 25 ? ? O A LEU 30 ? ? 1.57 2 15 HG A SER 8 ? ? OD1 A ASP 11 ? ? 1.58 3 16 HG A SER 8 ? ? OD1 A ASP 11 ? ? 1.56 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 CA A CYS 35 ? ? CB A CYS 35 ? ? SG A CYS 35 ? ? 121.68 114.20 7.48 1.10 N 2 5 CB A TYR 32 ? ? CG A TYR 32 ? ? CD1 A TYR 32 ? ? 117.24 121.00 -3.76 0.60 N 3 6 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 116.89 121.00 -4.11 0.60 N 4 6 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 123.49 120.30 3.19 0.50 N 5 8 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 117.10 121.00 -3.90 0.60 N 6 8 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 123.92 120.30 3.62 0.50 N 7 9 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 117.36 121.00 -3.64 0.60 N 8 11 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 117.38 121.00 -3.62 0.60 N 9 11 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 123.85 120.30 3.55 0.50 N 10 12 CA A THR 31 ? ? CB A THR 31 ? ? CG2 A THR 31 ? ? 102.19 112.40 -10.21 1.40 N 11 13 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 117.33 121.00 -3.67 0.60 N 12 13 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 124.00 120.30 3.70 0.50 N 13 14 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 116.89 121.00 -4.11 0.60 N 14 14 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 123.38 120.30 3.08 0.50 N 15 16 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 123.61 120.30 3.31 0.50 N 16 17 CA A CYS 18 ? ? CB A CYS 18 ? ? SG A CYS 18 ? ? 122.49 114.20 8.29 1.10 N 17 17 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 123.68 120.30 3.38 0.50 N 18 18 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 124.10 120.30 3.80 0.50 N 19 19 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 117.07 121.00 -3.93 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 17 ? ? -79.26 46.17 2 1 CYS A 21 ? ? -66.12 99.59 3 1 ASP A 26 ? ? -77.59 -156.40 4 2 CYS A 2 ? ? -68.55 84.42 5 3 SER A 7 ? ? -131.09 -36.42 6 3 LEU A 17 ? ? -73.37 22.58 7 3 GLN A 19 ? ? -67.22 7.09 8 3 ASP A 26 ? ? -77.58 -129.68 9 4 CYS A 2 ? ? -55.89 27.06 10 4 LEU A 17 ? ? -66.54 8.07 11 4 CYS A 21 ? ? -66.99 90.89 12 4 CYS A 35 ? ? -60.50 90.12 13 5 ASN A 3 ? ? -137.26 -52.95 14 5 LEU A 17 ? ? -68.65 19.31 15 5 CYS A 18 ? ? -96.94 58.64 16 5 CYS A 35 ? ? -63.67 98.35 17 6 SER A 7 ? ? -132.23 -41.46 18 6 CYS A 18 ? ? -77.61 38.20 19 6 GLN A 19 ? ? -59.76 13.16 20 7 CYS A 2 ? ? -45.83 102.95 21 7 ASN A 3 ? ? -140.17 -10.30 22 7 LEU A 17 ? ? -69.87 26.18 23 7 CYS A 18 ? ? -88.59 43.11 24 8 CYS A 2 ? ? -64.87 92.30 25 8 LEU A 17 ? ? -67.78 2.17 26 8 CYS A 18 ? ? -75.03 42.46 27 8 GLN A 19 ? ? -64.95 17.13 28 8 ASP A 26 ? ? -76.40 -109.14 29 9 CYS A 2 ? ? 53.09 6.03 30 9 LEU A 17 ? ? -66.57 7.09 31 9 CYS A 18 ? ? -75.06 37.37 32 9 CYS A 21 ? ? -66.98 72.43 33 9 ASP A 26 ? ? -82.00 -151.26 34 9 CYS A 35 ? ? -68.72 81.15 35 10 ASN A 3 ? ? -138.06 -47.13 36 10 LEU A 17 ? ? -66.68 20.38 37 10 CYS A 18 ? ? -90.33 48.55 38 10 PHE A 20 ? ? -100.39 79.63 39 10 ASP A 26 ? ? -73.47 -133.71 40 10 CYS A 35 ? ? -69.97 98.85 41 11 GLU A 4 ? ? 65.70 167.94 42 11 LEU A 17 ? ? -66.86 6.60 43 11 CYS A 18 ? ? -75.38 33.56 44 11 GLN A 19 ? ? -55.19 -7.09 45 11 ASP A 26 ? ? -76.59 -148.41 46 11 CYS A 35 ? ? -68.19 99.73 47 12 CYS A 2 ? ? -64.31 93.31 48 12 GLU A 4 ? ? 68.03 167.83 49 12 LEU A 17 ? ? -72.07 39.46 50 12 GLN A 19 ? ? -89.24 -139.16 51 12 PHE A 20 ? ? 29.25 56.76 52 13 GLU A 4 ? ? 62.13 162.59 53 13 ASP A 11 ? ? -66.44 4.59 54 13 CYS A 12 ? ? -140.89 -2.71 55 13 LEU A 17 ? ? -69.88 19.46 56 13 CYS A 18 ? ? -87.45 46.26 57 13 GLN A 19 ? ? -64.50 10.58 58 13 CYS A 35 ? ? -68.54 77.62 59 14 GLU A 4 ? ? 61.53 161.34 60 14 LEU A 17 ? ? -68.66 19.93 61 14 PHE A 20 ? ? -100.60 75.09 62 15 CYS A 2 ? ? -63.81 66.39 63 15 ASN A 3 ? ? -151.30 14.75 64 15 CYS A 21 ? ? -68.70 84.68 65 15 CYS A 35 ? ? -65.92 96.44 66 16 CYS A 2 ? ? 52.73 -5.80 67 16 ASN A 3 ? ? -71.08 24.70 68 16 GLN A 19 ? ? -69.36 7.41 69 16 PHE A 20 ? ? -117.55 74.44 70 16 CYS A 21 ? ? -67.41 93.90 71 17 CYS A 2 ? ? -69.40 50.92 72 17 ASN A 9 ? ? -69.82 62.62 73 17 SER A 10 ? ? -164.65 -35.87 74 17 ASP A 11 ? ? -69.96 11.85 75 17 CYS A 12 ? ? -142.34 -0.50 76 18 ASN A 3 ? ? -142.04 15.53 77 18 GLN A 19 ? ? -141.87 -6.26 78 19 CYS A 2 ? ? -69.70 58.54 79 19 GLU A 4 ? ? 63.11 163.19 80 19 CYS A 12 ? ? -144.79 11.28 81 19 LEU A 17 ? ? -67.32 24.33 82 19 CYS A 18 ? ? -117.19 63.29 83 20 CYS A 2 ? ? 25.58 60.50 84 20 GLU A 4 ? ? 66.96 154.51 85 20 LEU A 17 ? ? -70.36 40.78 86 20 CYS A 21 ? ? -67.79 85.46 87 20 GLN A 27 ? ? -66.63 1.12 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 33 ? ? 0.133 'SIDE CHAIN' 2 3 TYR A 32 ? ? 0.107 'SIDE CHAIN' 3 4 TYR A 28 ? ? 0.076 'SIDE CHAIN' 4 7 TYR A 32 ? ? 0.069 'SIDE CHAIN' 5 10 TYR A 32 ? ? 0.098 'SIDE CHAIN' 6 10 ARG A 33 ? ? 0.102 'SIDE CHAIN' 7 15 TYR A 32 ? ? 0.094 'SIDE CHAIN' 8 15 ARG A 33 ? ? 0.173 'SIDE CHAIN' 9 17 TYR A 32 ? ? 0.078 'SIDE CHAIN' 10 17 ARG A 33 ? ? 0.116 'SIDE CHAIN' 11 18 ARG A 33 ? ? 0.086 'SIDE CHAIN' 12 20 ARG A 33 ? ? 0.087 'SIDE CHAIN' #