data_2HUY # _entry.id 2HUY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2HUY RCSB RCSB038792 WWPDB D_1000038792 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2008-08-12 _pdbx_database_PDB_obs_spr.pdb_id 3C7I _pdbx_database_PDB_obs_spr.replace_pdb_id 2HUY _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2HUW _pdbx_database_related.details 'X-ray crystal structure of the Grb2-SH2 domain complexed to a constrained ligand, cpYVN' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2HUY _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-07-27 _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Benfield, A.P.' 1 'Martin, S.F.' 2 # _citation.id primary _citation.title 'Ligand Preorganization May Be Accompanied by Entropic Penalties in Protein-Ligand Interactions.' _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_volume 45 _citation.page_first 6830 _citation.page_last 6835 _citation.year 2006 _citation.journal_id_ASTM ACIEAY _citation.country GE _citation.journal_id_ISSN 0570-0833 _citation.journal_id_CSD 0179 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17001728 _citation.pdbx_database_id_DOI 10.1002/anie.200600844 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Benfield, A.P.' 1 primary 'Teresk, M.G.' 2 primary 'Plake, H.R.' 3 primary 'Delorbe, J.E.' 4 primary 'Millspaugh, L.E.' 5 primary 'Martin, S.F.' 6 # _cell.entry_id 2HUY _cell.length_a 42.053 _cell.length_b 42.053 _cell.length_c 109.426 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2HUY _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth factor receptor-bound protein 2' 13687.465 1 ? ? 'SH2 domain' ? 2 non-polymer syn 'N-({(1R,2R,3S)-2-(methylcarbamoyl)-3-[4-(phosphonooxy)phenyl]cyclopropyl}carbonyl)-L-valyl-L-aspartamide' 527.465 1 ? ? ? ? 3 non-polymer syn 'FORMIC ACID' 46.025 1 ? ? ? ? 4 water nat water 18.015 121 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 GLU n 1 3 MET n 1 4 LYS n 1 5 PRO n 1 6 HIS n 1 7 PRO n 1 8 TRP n 1 9 PHE n 1 10 PHE n 1 11 GLY n 1 12 LYS n 1 13 ILE n 1 14 PRO n 1 15 ARG n 1 16 ALA n 1 17 LYS n 1 18 ALA n 1 19 GLU n 1 20 GLU n 1 21 MET n 1 22 LEU n 1 23 SER n 1 24 LYS n 1 25 GLN n 1 26 ARG n 1 27 HIS n 1 28 ASP n 1 29 GLY n 1 30 ALA n 1 31 PHE n 1 32 LEU n 1 33 ILE n 1 34 ARG n 1 35 GLU n 1 36 SER n 1 37 GLU n 1 38 SER n 1 39 ALA n 1 40 PRO n 1 41 GLY n 1 42 ASP n 1 43 PHE n 1 44 SER n 1 45 LEU n 1 46 SER n 1 47 VAL n 1 48 LYS n 1 49 PHE n 1 50 GLY n 1 51 ASN n 1 52 ASP n 1 53 VAL n 1 54 GLN n 1 55 HIS n 1 56 PHE n 1 57 LYS n 1 58 VAL n 1 59 LEU n 1 60 ARG n 1 61 ASP n 1 62 GLY n 1 63 ALA n 1 64 GLY n 1 65 LYS n 1 66 TYR n 1 67 PHE n 1 68 LEU n 1 69 TRP n 1 70 VAL n 1 71 VAL n 1 72 LYS n 1 73 PHE n 1 74 ASN n 1 75 SER n 1 76 LEU n 1 77 ASN n 1 78 GLU n 1 79 LEU n 1 80 VAL n 1 81 ASP n 1 82 TYR n 1 83 HIS n 1 84 ARG n 1 85 SER n 1 86 THR n 1 87 SER n 1 88 VAL n 1 89 SER n 1 90 ARG n 1 91 ASN n 1 92 GLN n 1 93 GLN n 1 94 ILE n 1 95 PHE n 1 96 LEU n 1 97 ARG n 1 98 ASP n 1 99 ILE n 1 100 GLU n 1 101 GLN n 1 102 VAL n 1 103 PRO n 1 104 GLN n 1 105 GLN n 1 106 PRO n 1 107 THR n 1 108 TYR n 1 109 VAL n 1 110 GLN n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'GRB2, ASH' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GRB2_HUMAN _struct_ref.pdbx_db_accession P62993 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQ ; _struct_ref.pdbx_align_begin 53 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HUY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62993 _struct_ref_seq.db_align_beg 53 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 162 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 53 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HUY HIS A 111 ? UNP P62993 ? ? 'EXPRESSION TAG' 163 1 1 2HUY HIS A 112 ? UNP P62993 ? ? 'EXPRESSION TAG' 164 2 1 2HUY HIS A 113 ? UNP P62993 ? ? 'EXPRESSION TAG' 165 3 1 2HUY HIS A 114 ? UNP P62993 ? ? 'EXPRESSION TAG' 166 4 1 2HUY HIS A 115 ? UNP P62993 ? ? 'EXPRESSION TAG' 167 5 1 2HUY HIS A 116 ? UNP P62993 ? ? 'EXPRESSION TAG' 168 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YVN non-polymer . 'N-({(1R,2R,3S)-2-(methylcarbamoyl)-3-[4-(phosphonooxy)phenyl]cyclopropyl}carbonyl)-L-valyl-L-aspartamide' ? 'C21 H30 N5 O9 P' 527.465 # _exptl.crystals_number 1 _exptl.entry_id 2HUY _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 1.766466 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 30.369448 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details ;ligand (fpYVN) was added to a 1.5 molar excess to 15 mg/ml Grb2-SH2 in pure water. This solution was mixed with an equal volume of 4.0 M sodium formate. , pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2005-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 2HUY _reflns.d_resolution_high 1.700 _reflns.d_resolution_low 30.000 _reflns.number_obs 11224 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_netI_over_sigmaI 23.300 _reflns.pdbx_chi_squared 1.545 _reflns.pdbx_redundancy 5.200 _reflns.percent_possible_obs 97.200 _reflns.observed_criterion_sigma_F 1.0 _reflns.observed_criterion_sigma_I 1.0 _reflns.number_all 11224 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.70 1.76 ? ? ? 0.174 ? ? 1.423 2.60 ? 889 79.70 ? 1 1.76 1.83 ? ? ? 0.147 ? ? 1.635 3.60 ? 1039 92.80 ? 2 1.83 1.91 ? ? ? 0.128 ? ? 1.766 5.30 ? 1115 99.00 ? 3 1.91 2.02 ? ? ? 0.106 ? ? 1.838 5.70 ? 1115 100.00 ? 4 2.02 2.14 ? ? ? 0.086 ? ? 1.565 5.70 ? 1127 100.00 ? 5 2.14 2.31 ? ? ? 0.077 ? ? 1.580 5.80 ? 1149 100.00 ? 6 2.31 2.54 ? ? ? 0.069 ? ? 1.490 5.80 ? 1144 100.00 ? 7 2.54 2.91 ? ? ? 0.06 ? ? 1.400 5.80 ? 1157 100.00 ? 8 2.91 3.66 ? ? ? 0.047 ? ? 1.556 5.80 ? 1192 99.80 ? 9 3.66 30.00 ? ? ? 0.037 ? ? 1.208 5.40 ? 1297 99.60 ? 10 # _refine.entry_id 2HUY _refine.ls_d_res_high 1.700 _refine.ls_d_res_low 14.70 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 95.800 _refine.ls_number_reflns_obs 10985 _refine.ls_R_factor_R_work 0.207 _refine.ls_R_factor_R_free 0.234 _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 555 _refine.B_iso_mean 20.678 _refine.solvent_model_param_bsol 49.503 _refine.aniso_B[1][1] 0.698 _refine.aniso_B[2][2] 0.698 _refine.aniso_B[3][3] -1.397 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.overall_FOM_work_R_set 0.855 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 10985 _refine.ls_R_factor_all 0.207 _refine.ls_R_factor_obs 0.234 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 832 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.number_atoms_solvent 124 _refine_hist.number_atoms_total 992 _refine_hist.d_res_high 1.700 _refine_hist.d_res_low 14.70 _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.005 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.314 ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? 1.269 1.500 ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 1.851 2.000 ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 2.052 2.000 ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 2.754 2.500 ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 1.700 1.750 11 . 699 . 0.31 0.339 . 36 . . 735 . 'X-RAY DIFFRACTION' 1.750 1.820 11 . 850 . 0.247 0.248 . 34 . . 884 . 'X-RAY DIFFRACTION' 1.820 1.890 11 . 940 . 0.192 0.236 . 57 . . 997 . 'X-RAY DIFFRACTION' 1.890 1.980 11 . 969 . 0.206 0.257 . 45 . . 1014 . 'X-RAY DIFFRACTION' 1.980 2.080 11 . 963 . 0.198 0.205 . 53 . . 1016 . 'X-RAY DIFFRACTION' 2.080 2.210 11 . 983 . 0.184 0.206 . 50 . . 1033 . 'X-RAY DIFFRACTION' 2.210 2.380 11 . 983 . 0.196 0.26 . 45 . . 1028 . 'X-RAY DIFFRACTION' 2.380 2.620 11 . 987 . 0.2 0.223 . 57 . . 1044 . 'X-RAY DIFFRACTION' 2.620 3.000 11 . 1001 . 0.219 0.245 . 55 . . 1056 . 'X-RAY DIFFRACTION' 3.000 3.780 11 . 1004 . 0.176 0.193 . 67 . . 1071 . 'X-RAY DIFFRACTION' 3.780 30.000 11 . 1051 . 0.232 0.271 . 56 . . 1107 . 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 2 fpyvn.param fpyvn.top 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param CNS_TOPPAR:water.top 'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param CNS_TOPPAR:ion.top 'X-RAY DIFFRACTION' 5 formate.param formate.top 'X-RAY DIFFRACTION' # _struct.entry_id 2HUY _struct.title 'X-ray crystal structure of the complex between the Grb2-SH2 domain and a flexible ligand, fpYVN.' _struct.pdbx_descriptor 'Growth factor receptor-bound protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HUY _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR' _struct_keywords.text 'Flexible, constrained, entropy, Grb2-SH2, ligand preorganization, HORMONE-GROWTH FACTOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ;The biological unit of full length Grb2 consists of a single SH2 domain flanked on its N- and C- termini by SH3 domains. This crystal structure contains one SH2 domain fragment in the asymmetric unit. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 14 ? LYS A 24 ? PRO A 66 LYS A 76 1 ? 11 HELX_P HELX_P2 2 SER A 75 ? HIS A 83 ? SER A 127 HIS A 135 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 31 ? GLU A 35 ? PHE A 83 GLU A 87 A 2 PHE A 43 ? PHE A 49 ? PHE A 95 PHE A 101 A 3 ASP A 52 ? ARG A 60 ? ASP A 104 ARG A 112 A 4 TYR A 66 ? PHE A 67 ? TYR A 118 PHE A 119 A 5 LYS A 72 ? PHE A 73 ? LYS A 124 PHE A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 34 ? N ARG A 86 O SER A 44 ? O SER A 96 A 2 3 N LEU A 45 ? N LEU A 97 O PHE A 56 ? O PHE A 108 A 3 4 N LEU A 59 ? N LEU A 111 O PHE A 67 ? O PHE A 119 A 4 5 N TYR A 66 ? N TYR A 118 O PHE A 73 ? O PHE A 125 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'FMT BINDING SITE FOR RESIDUE A 201' AC2 Software ? ? ? ? 18 'YVN BINDING SITE FOR RESIDUE A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 26 ? ARG A 78 . ? 1_555 ? 2 AC1 4 HIS A 27 ? HIS A 79 . ? 1_555 ? 3 AC1 4 GLU A 100 ? GLU A 152 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 206 . ? 1_555 ? 5 AC2 18 ARG A 15 ? ARG A 67 . ? 1_555 ? 6 AC2 18 ARG A 34 ? ARG A 86 . ? 1_555 ? 7 AC2 18 SER A 36 ? SER A 88 . ? 1_555 ? 8 AC2 18 SER A 38 ? SER A 90 . ? 1_555 ? 9 AC2 18 SER A 44 ? SER A 96 . ? 1_555 ? 10 AC2 18 HIS A 55 ? HIS A 107 . ? 1_555 ? 11 AC2 18 PHE A 56 ? PHE A 108 . ? 1_555 ? 12 AC2 18 LYS A 57 ? LYS A 109 . ? 1_555 ? 13 AC2 18 LEU A 68 ? LEU A 120 . ? 1_555 ? 14 AC2 18 HOH D . ? HOH A 208 . ? 1_555 ? 15 AC2 18 HOH D . ? HOH A 209 . ? 1_555 ? 16 AC2 18 HOH D . ? HOH A 214 . ? 1_555 ? 17 AC2 18 HOH D . ? HOH A 237 . ? 1_555 ? 18 AC2 18 HOH D . ? HOH A 239 . ? 1_555 ? 19 AC2 18 HOH D . ? HOH A 240 . ? 1_555 ? 20 AC2 18 HOH D . ? HOH A 272 . ? 1_555 ? 21 AC2 18 HOH D . ? HOH A 290 . ? 1_555 ? 22 AC2 18 HOH D . ? HOH A 313 . ? 1_555 ? # _atom_sites.entry_id 2HUY _atom_sites.fract_transf_matrix[1][1] 0.023780 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023780 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009139 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 53 ? ? ? A . n A 1 2 GLU 2 54 ? ? ? A . n A 1 3 MET 3 55 55 MET MET A . n A 1 4 LYS 4 56 56 LYS LYS A . n A 1 5 PRO 5 57 57 PRO PRO A . n A 1 6 HIS 6 58 58 HIS HIS A . n A 1 7 PRO 7 59 59 PRO PRO A . n A 1 8 TRP 8 60 60 TRP TRP A . n A 1 9 PHE 9 61 61 PHE PHE A . n A 1 10 PHE 10 62 62 PHE PHE A . n A 1 11 GLY 11 63 63 GLY GLY A . n A 1 12 LYS 12 64 64 LYS LYS A . n A 1 13 ILE 13 65 65 ILE ILE A . n A 1 14 PRO 14 66 66 PRO PRO A . n A 1 15 ARG 15 67 67 ARG ARG A . n A 1 16 ALA 16 68 68 ALA ALA A . n A 1 17 LYS 17 69 69 LYS LYS A . n A 1 18 ALA 18 70 70 ALA ALA A . n A 1 19 GLU 19 71 71 GLU GLU A . n A 1 20 GLU 20 72 72 GLU GLU A . n A 1 21 MET 21 73 73 MET MET A . n A 1 22 LEU 22 74 74 LEU LEU A . n A 1 23 SER 23 75 75 SER SER A . n A 1 24 LYS 24 76 76 LYS LYS A . n A 1 25 GLN 25 77 77 GLN GLN A . n A 1 26 ARG 26 78 78 ARG ARG A . n A 1 27 HIS 27 79 79 HIS HIS A . n A 1 28 ASP 28 80 80 ASP ASP A . n A 1 29 GLY 29 81 81 GLY GLY A . n A 1 30 ALA 30 82 82 ALA ALA A . n A 1 31 PHE 31 83 83 PHE PHE A . n A 1 32 LEU 32 84 84 LEU LEU A . n A 1 33 ILE 33 85 85 ILE ILE A . n A 1 34 ARG 34 86 86 ARG ARG A . n A 1 35 GLU 35 87 87 GLU GLU A . n A 1 36 SER 36 88 88 SER SER A . n A 1 37 GLU 37 89 89 GLU GLU A . n A 1 38 SER 38 90 90 SER SER A . n A 1 39 ALA 39 91 91 ALA ALA A . n A 1 40 PRO 40 92 92 PRO PRO A . n A 1 41 GLY 41 93 93 GLY GLY A . n A 1 42 ASP 42 94 94 ASP ASP A . n A 1 43 PHE 43 95 95 PHE PHE A . n A 1 44 SER 44 96 96 SER SER A . n A 1 45 LEU 45 97 97 LEU LEU A . n A 1 46 SER 46 98 98 SER SER A . n A 1 47 VAL 47 99 99 VAL VAL A . n A 1 48 LYS 48 100 100 LYS LYS A . n A 1 49 PHE 49 101 101 PHE PHE A . n A 1 50 GLY 50 102 102 GLY GLY A . n A 1 51 ASN 51 103 103 ASN ASN A . n A 1 52 ASP 52 104 104 ASP ASP A . n A 1 53 VAL 53 105 105 VAL VAL A . n A 1 54 GLN 54 106 106 GLN GLN A . n A 1 55 HIS 55 107 107 HIS HIS A . n A 1 56 PHE 56 108 108 PHE PHE A . n A 1 57 LYS 57 109 109 LYS LYS A . n A 1 58 VAL 58 110 110 VAL VAL A . n A 1 59 LEU 59 111 111 LEU LEU A . n A 1 60 ARG 60 112 112 ARG ARG A . n A 1 61 ASP 61 113 113 ASP ASP A . n A 1 62 GLY 62 114 114 GLY GLY A . n A 1 63 ALA 63 115 115 ALA ALA A . n A 1 64 GLY 64 116 116 GLY GLY A . n A 1 65 LYS 65 117 117 LYS LYS A . n A 1 66 TYR 66 118 118 TYR TYR A . n A 1 67 PHE 67 119 119 PHE PHE A . n A 1 68 LEU 68 120 120 LEU LEU A . n A 1 69 TRP 69 121 121 TRP TRP A . n A 1 70 VAL 70 122 122 VAL VAL A . n A 1 71 VAL 71 123 123 VAL VAL A . n A 1 72 LYS 72 124 124 LYS LYS A . n A 1 73 PHE 73 125 125 PHE PHE A . n A 1 74 ASN 74 126 126 ASN ASN A . n A 1 75 SER 75 127 127 SER SER A . n A 1 76 LEU 76 128 128 LEU LEU A . n A 1 77 ASN 77 129 129 ASN ASN A . n A 1 78 GLU 78 130 130 GLU GLU A . n A 1 79 LEU 79 131 131 LEU LEU A . n A 1 80 VAL 80 132 132 VAL VAL A . n A 1 81 ASP 81 133 133 ASP ASP A . n A 1 82 TYR 82 134 134 TYR TYR A . n A 1 83 HIS 83 135 135 HIS HIS A . n A 1 84 ARG 84 136 136 ARG ARG A . n A 1 85 SER 85 137 137 SER SER A . n A 1 86 THR 86 138 138 THR THR A . n A 1 87 SER 87 139 139 SER SER A . n A 1 88 VAL 88 140 140 VAL VAL A . n A 1 89 SER 89 141 141 SER SER A . n A 1 90 ARG 90 142 142 ARG ARG A . n A 1 91 ASN 91 143 143 ASN ASN A . n A 1 92 GLN 92 144 144 GLN GLN A . n A 1 93 GLN 93 145 145 GLN GLN A . n A 1 94 ILE 94 146 146 ILE ILE A . n A 1 95 PHE 95 147 147 PHE PHE A . n A 1 96 LEU 96 148 148 LEU LEU A . n A 1 97 ARG 97 149 149 ARG ARG A . n A 1 98 ASP 98 150 150 ASP ASP A . n A 1 99 ILE 99 151 151 ILE ILE A . n A 1 100 GLU 100 152 152 GLU GLU A . n A 1 101 GLN 101 153 153 GLN GLN A . n A 1 102 VAL 102 154 154 VAL VAL A . n A 1 103 PRO 103 155 155 PRO PRO A . n A 1 104 GLN 104 156 ? ? ? A . n A 1 105 GLN 105 157 ? ? ? A . n A 1 106 PRO 106 158 ? ? ? A . n A 1 107 THR 107 159 ? ? ? A . n A 1 108 TYR 108 160 ? ? ? A . n A 1 109 VAL 109 161 ? ? ? A . n A 1 110 GLN 110 162 ? ? ? A . n A 1 111 HIS 111 163 ? ? ? A . n A 1 112 HIS 112 164 ? ? ? A . n A 1 113 HIS 113 165 ? ? ? A . n A 1 114 HIS 114 166 ? ? ? A . n A 1 115 HIS 115 167 ? ? ? A . n A 1 116 HIS 116 168 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 YVN 1 202 202 YVN YVN A . C 3 FMT 1 201 201 FMT FMT A . D 4 HOH 1 203 1 HOH HOH A . D 4 HOH 2 204 2 HOH HOH A . D 4 HOH 3 205 3 HOH HOH A . D 4 HOH 4 206 4 HOH HOH A . D 4 HOH 5 207 5 HOH HOH A . D 4 HOH 6 208 6 HOH HOH A . D 4 HOH 7 209 7 HOH HOH A . D 4 HOH 8 210 8 HOH HOH A . D 4 HOH 9 211 9 HOH HOH A . D 4 HOH 10 212 10 HOH HOH A . D 4 HOH 11 213 11 HOH HOH A . D 4 HOH 12 214 12 HOH HOH A . D 4 HOH 13 215 13 HOH HOH A . D 4 HOH 14 216 14 HOH HOH A . D 4 HOH 15 217 15 HOH HOH A . D 4 HOH 16 218 16 HOH HOH A . D 4 HOH 17 219 17 HOH HOH A . D 4 HOH 18 220 18 HOH HOH A . D 4 HOH 19 221 19 HOH HOH A . D 4 HOH 20 222 20 HOH HOH A . D 4 HOH 21 223 21 HOH HOH A . D 4 HOH 22 224 22 HOH HOH A . D 4 HOH 23 225 23 HOH HOH A . D 4 HOH 24 226 24 HOH HOH A . D 4 HOH 25 227 25 HOH HOH A . D 4 HOH 26 228 26 HOH HOH A . D 4 HOH 27 229 27 HOH HOH A . D 4 HOH 28 230 28 HOH HOH A . D 4 HOH 29 231 29 HOH HOH A . D 4 HOH 30 232 30 HOH HOH A . D 4 HOH 31 233 31 HOH HOH A . D 4 HOH 32 234 32 HOH HOH A . D 4 HOH 33 235 33 HOH HOH A . D 4 HOH 34 236 34 HOH HOH A . D 4 HOH 35 237 35 HOH HOH A . D 4 HOH 36 238 36 HOH HOH A . D 4 HOH 37 239 37 HOH HOH A . D 4 HOH 38 240 38 HOH HOH A . D 4 HOH 39 241 39 HOH HOH A . D 4 HOH 40 242 40 HOH HOH A . D 4 HOH 41 243 41 HOH HOH A . D 4 HOH 42 244 42 HOH HOH A . D 4 HOH 43 245 43 HOH HOH A . D 4 HOH 44 246 44 HOH HOH A . D 4 HOH 45 247 45 HOH HOH A . D 4 HOH 46 248 46 HOH HOH A . D 4 HOH 47 249 47 HOH HOH A . D 4 HOH 48 250 48 HOH HOH A . D 4 HOH 49 251 49 HOH HOH A . D 4 HOH 50 252 50 HOH HOH A . D 4 HOH 51 253 51 HOH HOH A . D 4 HOH 52 254 52 HOH HOH A . D 4 HOH 53 255 53 HOH HOH A . D 4 HOH 54 256 54 HOH HOH A . D 4 HOH 55 257 55 HOH HOH A . D 4 HOH 56 258 56 HOH HOH A . D 4 HOH 57 259 57 HOH HOH A . D 4 HOH 58 260 58 HOH HOH A . D 4 HOH 59 261 59 HOH HOH A . D 4 HOH 60 262 60 HOH HOH A . D 4 HOH 61 263 61 HOH HOH A . D 4 HOH 62 264 62 HOH HOH A . D 4 HOH 63 265 63 HOH HOH A . D 4 HOH 64 266 64 HOH HOH A . D 4 HOH 65 267 65 HOH HOH A . D 4 HOH 66 268 66 HOH HOH A . D 4 HOH 67 269 67 HOH HOH A . D 4 HOH 68 270 68 HOH HOH A . D 4 HOH 69 271 69 HOH HOH A . D 4 HOH 70 272 70 HOH HOH A . D 4 HOH 71 273 71 HOH HOH A . D 4 HOH 72 274 72 HOH HOH A . D 4 HOH 73 275 73 HOH HOH A . D 4 HOH 74 276 74 HOH HOH A . D 4 HOH 75 277 75 HOH HOH A . D 4 HOH 76 278 76 HOH HOH A . D 4 HOH 77 279 77 HOH HOH A . D 4 HOH 78 280 78 HOH HOH A . D 4 HOH 79 281 79 HOH HOH A . D 4 HOH 80 282 80 HOH HOH A . D 4 HOH 81 283 81 HOH HOH A . D 4 HOH 82 284 82 HOH HOH A . D 4 HOH 83 285 83 HOH HOH A . D 4 HOH 84 286 84 HOH HOH A . D 4 HOH 85 287 85 HOH HOH A . D 4 HOH 86 288 86 HOH HOH A . D 4 HOH 87 289 87 HOH HOH A . D 4 HOH 88 290 88 HOH HOH A . D 4 HOH 89 291 89 HOH HOH A . D 4 HOH 90 292 90 HOH HOH A . D 4 HOH 91 293 91 HOH HOH A . D 4 HOH 92 294 92 HOH HOH A . D 4 HOH 93 295 93 HOH HOH A . D 4 HOH 94 296 94 HOH HOH A . D 4 HOH 95 297 95 HOH HOH A . D 4 HOH 96 298 96 HOH HOH A . D 4 HOH 97 299 97 HOH HOH A . D 4 HOH 98 300 98 HOH HOH A . D 4 HOH 99 301 99 HOH HOH A . D 4 HOH 100 302 100 HOH HOH A . D 4 HOH 101 303 101 HOH HOH A . D 4 HOH 102 304 102 HOH HOH A . D 4 HOH 103 305 103 HOH HOH A . D 4 HOH 104 306 104 HOH HOH A . D 4 HOH 105 307 105 HOH HOH A . D 4 HOH 106 308 106 HOH HOH A . D 4 HOH 107 309 107 HOH HOH A . D 4 HOH 108 310 108 HOH HOH A . D 4 HOH 109 311 109 HOH HOH A . D 4 HOH 110 312 110 HOH HOH A . D 4 HOH 111 313 111 HOH HOH A . D 4 HOH 112 314 113 HOH HOH A . D 4 HOH 113 315 114 HOH HOH A . D 4 HOH 114 316 115 HOH HOH A . D 4 HOH 115 317 116 HOH HOH A . D 4 HOH 116 318 117 HOH HOH A . D 4 HOH 117 319 118 HOH HOH A . D 4 HOH 118 320 119 HOH HOH A . D 4 HOH 119 321 120 HOH HOH A . D 4 HOH 120 322 121 HOH HOH A . D 4 HOH 121 323 122 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-15 2 'Structure model' 1 1 2008-08-12 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal HKL . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data processing' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 2 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 3 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4 HKL . ? ? ? ? 'data scaling' ? ? ? 5 CCP4 . ? ? ? ? phasing ? ? ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 121 ? ? -123.59 -69.89 2 1 VAL A 122 ? ? -130.23 -50.39 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 53 ? A ILE 1 2 1 Y 1 A GLU 54 ? A GLU 2 3 1 Y 1 A GLN 156 ? A GLN 104 4 1 Y 1 A GLN 157 ? A GLN 105 5 1 Y 1 A PRO 158 ? A PRO 106 6 1 Y 1 A THR 159 ? A THR 107 7 1 Y 1 A TYR 160 ? A TYR 108 8 1 Y 1 A VAL 161 ? A VAL 109 9 1 Y 1 A GLN 162 ? A GLN 110 10 1 Y 1 A HIS 163 ? A HIS 111 11 1 Y 1 A HIS 164 ? A HIS 112 12 1 Y 1 A HIS 165 ? A HIS 113 13 1 Y 1 A HIS 166 ? A HIS 114 14 1 Y 1 A HIS 167 ? A HIS 115 15 1 Y 1 A HIS 168 ? A HIS 116 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-({(1R,2R,3S)-2-(methylcarbamoyl)-3-[4-(phosphonooxy)phenyl]cyclopropyl}carbonyl)-L-valyl-L-aspartamide' YVN 3 'FORMIC ACID' FMT 4 water HOH #