data_2HUY
#
_entry.id 2HUY
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.280
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
PDB 2HUY
RCSB RCSB038792
WWPDB D_1000038792
#
_pdbx_database_PDB_obs_spr.id OBSLTE
_pdbx_database_PDB_obs_spr.date 2008-08-12
_pdbx_database_PDB_obs_spr.pdb_id 3C7I
_pdbx_database_PDB_obs_spr.replace_pdb_id 2HUY
_pdbx_database_PDB_obs_spr.details ?
#
_pdbx_database_related.db_name PDB
_pdbx_database_related.db_id 2HUW
_pdbx_database_related.details 'X-ray crystal structure of the Grb2-SH2 domain complexed to a constrained ligand, cpYVN'
_pdbx_database_related.content_type unspecified
#
_pdbx_database_status.entry_id 2HUY
_pdbx_database_status.deposit_site RCSB
_pdbx_database_status.process_site RCSB
_pdbx_database_status.recvd_initial_deposition_date 2006-07-27
_pdbx_database_status.status_code OBS
_pdbx_database_status.status_code_sf OBS
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.SG_entry ?
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.pdb_format_compatible Y
_pdbx_database_status.methods_development_category ?
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Benfield, A.P.' 1
'Martin, S.F.' 2
#
_citation.id primary
_citation.title
'Ligand Preorganization May Be Accompanied by Entropic Penalties in Protein-Ligand Interactions.'
_citation.journal_abbrev Angew.Chem.Int.Ed.Engl.
_citation.journal_volume 45
_citation.page_first 6830
_citation.page_last 6835
_citation.year 2006
_citation.journal_id_ASTM ACIEAY
_citation.country GE
_citation.journal_id_ISSN 0570-0833
_citation.journal_id_CSD 0179
_citation.book_publisher ?
_citation.pdbx_database_id_PubMed 17001728
_citation.pdbx_database_id_DOI 10.1002/anie.200600844
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Benfield, A.P.' 1
primary 'Teresk, M.G.' 2
primary 'Plake, H.R.' 3
primary 'Delorbe, J.E.' 4
primary 'Millspaugh, L.E.' 5
primary 'Martin, S.F.' 6
#
_cell.entry_id 2HUY
_cell.length_a 42.053
_cell.length_b 42.053
_cell.length_c 109.426
_cell.angle_alpha 90.00
_cell.angle_beta 90.00
_cell.angle_gamma 90.00
_cell.Z_PDB 8
_cell.pdbx_unique_axis ?
_cell.length_a_esd ?
_cell.length_b_esd ?
_cell.length_c_esd ?
_cell.angle_alpha_esd ?
_cell.angle_beta_esd ?
_cell.angle_gamma_esd ?
#
_symmetry.entry_id 2HUY
_symmetry.space_group_name_H-M 'P 43 21 2'
_symmetry.pdbx_full_space_group_name_H-M ?
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 96
_symmetry.space_group_name_Hall ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Growth factor receptor-bound protein 2'
13687.465 1 ? ? 'SH2 domain' ?
2 non-polymer syn 'N-({(1R,2R,3S)-2-(methylcarbamoyl)-3-[4-(phosphonooxy)phenyl]cyclopropyl}carbonyl)-L-valyl-L-aspartamide'
527.465 1 ? ? ? ?
3 non-polymer syn 'FORMIC ACID'
46.025 1 ? ? ? ?
4 water nat water
18.015 121 ? ? ? ?
#
_entity_name_com.entity_id 1
_entity_name_com.name 'Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash'
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV
DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can
;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV
DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 ILE n
1 2 GLU n
1 3 MET n
1 4 LYS n
1 5 PRO n
1 6 HIS n
1 7 PRO n
1 8 TRP n
1 9 PHE n
1 10 PHE n
1 11 GLY n
1 12 LYS n
1 13 ILE n
1 14 PRO n
1 15 ARG n
1 16 ALA n
1 17 LYS n
1 18 ALA n
1 19 GLU n
1 20 GLU n
1 21 MET n
1 22 LEU n
1 23 SER n
1 24 LYS n
1 25 GLN n
1 26 ARG n
1 27 HIS n
1 28 ASP n
1 29 GLY n
1 30 ALA n
1 31 PHE n
1 32 LEU n
1 33 ILE n
1 34 ARG n
1 35 GLU n
1 36 SER n
1 37 GLU n
1 38 SER n
1 39 ALA n
1 40 PRO n
1 41 GLY n
1 42 ASP n
1 43 PHE n
1 44 SER n
1 45 LEU n
1 46 SER n
1 47 VAL n
1 48 LYS n
1 49 PHE n
1 50 GLY n
1 51 ASN n
1 52 ASP n
1 53 VAL n
1 54 GLN n
1 55 HIS n
1 56 PHE n
1 57 LYS n
1 58 VAL n
1 59 LEU n
1 60 ARG n
1 61 ASP n
1 62 GLY n
1 63 ALA n
1 64 GLY n
1 65 LYS n
1 66 TYR n
1 67 PHE n
1 68 LEU n
1 69 TRP n
1 70 VAL n
1 71 VAL n
1 72 LYS n
1 73 PHE n
1 74 ASN n
1 75 SER n
1 76 LEU n
1 77 ASN n
1 78 GLU n
1 79 LEU n
1 80 VAL n
1 81 ASP n
1 82 TYR n
1 83 HIS n
1 84 ARG n
1 85 SER n
1 86 THR n
1 87 SER n
1 88 VAL n
1 89 SER n
1 90 ARG n
1 91 ASN n
1 92 GLN n
1 93 GLN n
1 94 ILE n
1 95 PHE n
1 96 LEU n
1 97 ARG n
1 98 ASP n
1 99 ILE n
1 100 GLU n
1 101 GLN n
1 102 VAL n
1 103 PRO n
1 104 GLN n
1 105 GLN n
1 106 PRO n
1 107 THR n
1 108 TYR n
1 109 VAL n
1 110 GLN n
1 111 HIS n
1 112 HIS n
1 113 HIS n
1 114 HIS n
1 115 HIS n
1 116 HIS n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type ?
_entity_src_gen.pdbx_beg_seq_num ?
_entity_src_gen.pdbx_end_seq_num ?
_entity_src_gen.gene_src_common_name human
_entity_src_gen.gene_src_genus Homo
_entity_src_gen.pdbx_gene_src_gene 'GRB2, ASH'
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562
_entity_src_gen.host_org_genus Escherichia
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code GRB2_HUMAN
_struct_ref.pdbx_db_accession P62993
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV
DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQ
;
_struct_ref.pdbx_align_begin 53
_struct_ref.pdbx_db_isoform ?
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 2HUY
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 1
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 110
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession P62993
_struct_ref_seq.db_align_beg 53
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 162
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 53
_struct_ref_seq.pdbx_auth_seq_align_end 162
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 2HUY HIS A 111 ? UNP P62993 ? ? 'EXPRESSION TAG' 163 1
1 2HUY HIS A 112 ? UNP P62993 ? ? 'EXPRESSION TAG' 164 2
1 2HUY HIS A 113 ? UNP P62993 ? ? 'EXPRESSION TAG' 165 3
1 2HUY HIS A 114 ? UNP P62993 ? ? 'EXPRESSION TAG' 166 4
1 2HUY HIS A 115 ? UNP P62993 ? ? 'EXPRESSION TAG' 167 5
1 2HUY HIS A 116 ? UNP P62993 ? ? 'EXPRESSION TAG' 168 6
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ? 'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
YVN non-polymer .
'N-({(1R,2R,3S)-2-(methylcarbamoyl)-3-[4-(phosphonooxy)phenyl]cyclopropyl}carbonyl)-L-valyl-L-aspartamide' ? 'C21 H30 N5 O9 P'
527.465
#
_exptl.crystals_number 1
_exptl.entry_id 2HUY
_exptl.method 'X-RAY DIFFRACTION'
#
_exptl_crystal.id 1
_exptl_crystal.density_Matthews 1.766466
_exptl_crystal.density_meas ?
_exptl_crystal.density_percent_sol 30.369448
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.preparation ?
#
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP'
_exptl_crystal_grow.pH 5.0
_exptl_crystal_grow.temp 293
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.pdbx_details
;ligand (fpYVN) was added to a 1.5 molar excess to 15 mg/ml Grb2-SH2 in pure water. This solution was mixed with an equal volume of 4.0 M sodium formate. , pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range .
#
_diffrn.id 1
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.crystal_id 1
#
_diffrn_detector.diffrn_id 1
_diffrn_detector.detector 'IMAGE PLATE'
_diffrn_detector.type 'RIGAKU RAXIS IV'
_diffrn_detector.pdbx_collection_date 2005-01-01
_diffrn_detector.details ?
#
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.monochromator ?
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 1.5418
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.diffrn_id 1
_diffrn_source.source 'ROTATING ANODE'
_diffrn_source.type 'RIGAKU RU200'
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_wavelength_list 1.5418
_diffrn_source.pdbx_synchrotron_site ?
_diffrn_source.pdbx_synchrotron_beamline ?
#
_reflns.entry_id 2HUY
_reflns.d_resolution_high 1.700
_reflns.d_resolution_low 30.000
_reflns.number_obs 11224
_reflns.pdbx_Rmerge_I_obs 0.054
_reflns.pdbx_netI_over_sigmaI 23.300
_reflns.pdbx_chi_squared 1.545
_reflns.pdbx_redundancy 5.200
_reflns.percent_possible_obs 97.200
_reflns.observed_criterion_sigma_F 1.0
_reflns.observed_criterion_sigma_I 1.0
_reflns.number_all 11224
_reflns.pdbx_Rsym_value ?
_reflns.B_iso_Wilson_estimate ?
_reflns.R_free_details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
#
loop_
_reflns_shell.d_res_high
_reflns_shell.d_res_low
_reflns_shell.number_measured_obs
_reflns_shell.number_measured_all
_reflns_shell.number_unique_obs
_reflns_shell.Rmerge_I_obs
_reflns_shell.meanI_over_sigI_obs
_reflns_shell.pdbx_Rsym_value
_reflns_shell.pdbx_chi_squared
_reflns_shell.pdbx_redundancy
_reflns_shell.percent_possible_obs
_reflns_shell.number_unique_all
_reflns_shell.percent_possible_all
_reflns_shell.pdbx_diffrn_id
_reflns_shell.pdbx_ordinal
1.70 1.76 ? ? ? 0.174 ? ? 1.423 2.60 ? 889 79.70 ? 1
1.76 1.83 ? ? ? 0.147 ? ? 1.635 3.60 ? 1039 92.80 ? 2
1.83 1.91 ? ? ? 0.128 ? ? 1.766 5.30 ? 1115 99.00 ? 3
1.91 2.02 ? ? ? 0.106 ? ? 1.838 5.70 ? 1115 100.00 ? 4
2.02 2.14 ? ? ? 0.086 ? ? 1.565 5.70 ? 1127 100.00 ? 5
2.14 2.31 ? ? ? 0.077 ? ? 1.580 5.80 ? 1149 100.00 ? 6
2.31 2.54 ? ? ? 0.069 ? ? 1.490 5.80 ? 1144 100.00 ? 7
2.54 2.91 ? ? ? 0.06 ? ? 1.400 5.80 ? 1157 100.00 ? 8
2.91 3.66 ? ? ? 0.047 ? ? 1.556 5.80 ? 1192 99.80 ? 9
3.66 30.00 ? ? ? 0.037 ? ? 1.208 5.40 ? 1297 99.60 ? 10
#
_refine.entry_id 2HUY
_refine.ls_d_res_high 1.700
_refine.ls_d_res_low 14.70
_refine.pdbx_ls_sigma_F 0.00
_refine.ls_percent_reflns_obs 95.800
_refine.ls_number_reflns_obs 10985
_refine.ls_R_factor_R_work 0.207
_refine.ls_R_factor_R_free 0.234
_refine.ls_percent_reflns_R_free 4.800
_refine.ls_number_reflns_R_free 555
_refine.B_iso_mean 20.678
_refine.solvent_model_param_bsol 49.503
_refine.aniso_B[1][1] 0.698
_refine.aniso_B[2][2] 0.698
_refine.aniso_B[3][3] -1.397
_refine.aniso_B[1][2] 0.000
_refine.aniso_B[1][3] 0.000
_refine.aniso_B[2][3] 0.000
_refine.overall_FOM_work_R_set 0.855
_refine.pdbx_ls_sigma_I ?
_refine.ls_number_reflns_all 10985
_refine.ls_R_factor_all 0.207
_refine.ls_R_factor_obs 0.234
_refine.ls_redundancy_reflns_obs ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.ls_number_parameters ?
_refine.ls_number_restraints ?
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model ?
_refine.pdbx_ls_cross_valid_method ?
_refine.pdbx_R_Free_selection_details random
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_stereochemistry_target_values 'Engh & Huber'
_refine.solvent_model_details ?
_refine.solvent_model_param_ksol ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.pdbx_isotropic_thermal_model ?
_refine.details ?
_refine.B_iso_min ?
_refine.B_iso_max ?
_refine.correlation_coeff_Fo_to_Fc ?
_refine.correlation_coeff_Fo_to_Fc_free ?
_refine.pdbx_solvent_vdw_probe_radii ?
_refine.pdbx_solvent_ion_probe_radii ?
_refine.pdbx_solvent_shrinkage_radii ?
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_SU_ML ?
_refine.overall_SU_B ?
_refine.pdbx_overall_ESU_R_Free ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_overall_ESU_R ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.overall_FOM_free_R_set ?
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.pdbx_diffrn_id 1
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
#
_refine_hist.cycle_id LAST
_refine_hist.pdbx_number_atoms_protein 832
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 36
_refine_hist.number_atoms_solvent 124
_refine_hist.number_atoms_total 992
_refine_hist.d_res_high 1.700
_refine_hist.d_res_low 14.70
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
#
loop_
_refine_ls_restr.type
_refine_ls_restr.number
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.weight
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.pdbx_restraint_function
c_bond_d ? 0.005 ? ? 'X-RAY DIFFRACTION' ?
c_angle_deg ? 1.314 ? ? 'X-RAY DIFFRACTION' ?
c_mcbond_it ? 1.269 1.500 ? 'X-RAY DIFFRACTION' ?
c_scbond_it ? 1.851 2.000 ? 'X-RAY DIFFRACTION' ?
c_mcangle_it ? 2.052 2.000 ? 'X-RAY DIFFRACTION' ?
c_scangle_it ? 2.754 2.500 ? 'X-RAY DIFFRACTION' ?
#
loop_
_refine_ls_shell.d_res_high
_refine_ls_shell.d_res_low
_refine_ls_shell.pdbx_total_number_of_bins_used
_refine_ls_shell.percent_reflns_obs
_refine_ls_shell.number_reflns_R_work
_refine_ls_shell.R_factor_all
_refine_ls_shell.R_factor_R_work
_refine_ls_shell.R_factor_R_free
_refine_ls_shell.percent_reflns_R_free
_refine_ls_shell.number_reflns_R_free
_refine_ls_shell.R_factor_R_free_error
_refine_ls_shell.number_reflns_all
_refine_ls_shell.number_reflns_obs
_refine_ls_shell.redundancy_reflns_obs
_refine_ls_shell.pdbx_refine_id
1.700 1.750 11 . 699 . 0.31 0.339 . 36 . . 735 . 'X-RAY DIFFRACTION'
1.750 1.820 11 . 850 . 0.247 0.248 . 34 . . 884 . 'X-RAY DIFFRACTION'
1.820 1.890 11 . 940 . 0.192 0.236 . 57 . . 997 . 'X-RAY DIFFRACTION'
1.890 1.980 11 . 969 . 0.206 0.257 . 45 . . 1014 . 'X-RAY DIFFRACTION'
1.980 2.080 11 . 963 . 0.198 0.205 . 53 . . 1016 . 'X-RAY DIFFRACTION'
2.080 2.210 11 . 983 . 0.184 0.206 . 50 . . 1033 . 'X-RAY DIFFRACTION'
2.210 2.380 11 . 983 . 0.196 0.26 . 45 . . 1028 . 'X-RAY DIFFRACTION'
2.380 2.620 11 . 987 . 0.2 0.223 . 57 . . 1044 . 'X-RAY DIFFRACTION'
2.620 3.000 11 . 1001 . 0.219 0.245 . 55 . . 1056 . 'X-RAY DIFFRACTION'
3.000 3.780 11 . 1004 . 0.176 0.193 . 67 . . 1071 . 'X-RAY DIFFRACTION'
3.780 30.000 11 . 1051 . 0.232 0.271 . 56 . . 1107 . 'X-RAY DIFFRACTION'
#
loop_
_pdbx_xplor_file.serial_no
_pdbx_xplor_file.param_file
_pdbx_xplor_file.topol_file
_pdbx_xplor_file.pdbx_refine_id
1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION'
2 fpyvn.param fpyvn.top 'X-RAY DIFFRACTION'
3 CNS_TOPPAR:water_rep.param CNS_TOPPAR:water.top 'X-RAY DIFFRACTION'
4 CNS_TOPPAR:ion.param CNS_TOPPAR:ion.top 'X-RAY DIFFRACTION'
5 formate.param formate.top 'X-RAY DIFFRACTION'
#
_struct.entry_id 2HUY
_struct.title
'X-ray crystal structure of the complex between the Grb2-SH2 domain and a flexible ligand, fpYVN.'
_struct.pdbx_descriptor 'Growth factor receptor-bound protein 2'
_struct.pdbx_model_details ?
_struct.pdbx_CASP_flag ?
_struct.pdbx_model_type_details ?
#
_struct_keywords.entry_id 2HUY
_struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR'
_struct_keywords.text 'Flexible, constrained, entropy, Grb2-SH2, ligand preorganization, HORMONE-GROWTH FACTOR COMPLEX'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
D N N 4 ?
#
_struct_biol.id 1
_struct_biol.details
;The biological unit of full length Grb2 consists of a single SH2 domain flanked on its N- and C- termini by SH3 domains. This crystal structure contains one SH2 domain fragment in the asymmetric unit.
;
_struct_biol.pdbx_parent_biol_id ?
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 1 PRO A 14 ? LYS A 24 ? PRO A 66 LYS A 76 1 ? 11
HELX_P HELX_P2 2 SER A 75 ? HIS A 83 ? SER A 127 HIS A 135 1 ? 9
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
_struct_sheet.id A
_struct_sheet.type ?
_struct_sheet.number_strands 5
_struct_sheet.details ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
A 1 2 ? anti-parallel
A 2 3 ? anti-parallel
A 3 4 ? anti-parallel
A 4 5 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
A 1 PHE A 31 ? GLU A 35 ? PHE A 83 GLU A 87
A 2 PHE A 43 ? PHE A 49 ? PHE A 95 PHE A 101
A 3 ASP A 52 ? ARG A 60 ? ASP A 104 ARG A 112
A 4 TYR A 66 ? PHE A 67 ? TYR A 118 PHE A 119
A 5 LYS A 72 ? PHE A 73 ? LYS A 124 PHE A 125
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
A 1 2 N ARG A 34 ? N ARG A 86 O SER A 44 ? O SER A 96
A 2 3 N LEU A 45 ? N LEU A 97 O PHE A 56 ? O PHE A 108
A 3 4 N LEU A 59 ? N LEU A 111 O PHE A 67 ? O PHE A 119
A 4 5 N TYR A 66 ? N TYR A 118 O PHE A 73 ? O PHE A 125
#
loop_
_struct_site.id
_struct_site.pdbx_evidence_code
_struct_site.pdbx_auth_asym_id
_struct_site.pdbx_auth_comp_id
_struct_site.pdbx_auth_seq_id
_struct_site.pdbx_auth_ins_code
_struct_site.pdbx_num_residues
_struct_site.details
AC1 Software ? ? ? ? 4 'FMT BINDING SITE FOR RESIDUE A 201'
AC2 Software ? ? ? ? 18 'YVN BINDING SITE FOR RESIDUE A 202'
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 4 ARG A 26 ? ARG A 78 . ? 1_555 ?
2 AC1 4 HIS A 27 ? HIS A 79 . ? 1_555 ?
3 AC1 4 GLU A 100 ? GLU A 152 . ? 1_555 ?
4 AC1 4 HOH D . ? HOH A 206 . ? 1_555 ?
5 AC2 18 ARG A 15 ? ARG A 67 . ? 1_555 ?
6 AC2 18 ARG A 34 ? ARG A 86 . ? 1_555 ?
7 AC2 18 SER A 36 ? SER A 88 . ? 1_555 ?
8 AC2 18 SER A 38 ? SER A 90 . ? 1_555 ?
9 AC2 18 SER A 44 ? SER A 96 . ? 1_555 ?
10 AC2 18 HIS A 55 ? HIS A 107 . ? 1_555 ?
11 AC2 18 PHE A 56 ? PHE A 108 . ? 1_555 ?
12 AC2 18 LYS A 57 ? LYS A 109 . ? 1_555 ?
13 AC2 18 LEU A 68 ? LEU A 120 . ? 1_555 ?
14 AC2 18 HOH D . ? HOH A 208 . ? 1_555 ?
15 AC2 18 HOH D . ? HOH A 209 . ? 1_555 ?
16 AC2 18 HOH D . ? HOH A 214 . ? 1_555 ?
17 AC2 18 HOH D . ? HOH A 237 . ? 1_555 ?
18 AC2 18 HOH D . ? HOH A 239 . ? 1_555 ?
19 AC2 18 HOH D . ? HOH A 240 . ? 1_555 ?
20 AC2 18 HOH D . ? HOH A 272 . ? 1_555 ?
21 AC2 18 HOH D . ? HOH A 290 . ? 1_555 ?
22 AC2 18 HOH D . ? HOH A 313 . ? 1_555 ?
#
_atom_sites.entry_id 2HUY
_atom_sites.fract_transf_matrix[1][1] 0.023780
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.023780
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.009139
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
#
loop_
_atom_type.symbol
C
N
O
P
S
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 ILE 1 53 ? ? ? A . n
A 1 2 GLU 2 54 ? ? ? A . n
A 1 3 MET 3 55 55 MET MET A . n
A 1 4 LYS 4 56 56 LYS LYS A . n
A 1 5 PRO 5 57 57 PRO PRO A . n
A 1 6 HIS 6 58 58 HIS HIS A . n
A 1 7 PRO 7 59 59 PRO PRO A . n
A 1 8 TRP 8 60 60 TRP TRP A . n
A 1 9 PHE 9 61 61 PHE PHE A . n
A 1 10 PHE 10 62 62 PHE PHE A . n
A 1 11 GLY 11 63 63 GLY GLY A . n
A 1 12 LYS 12 64 64 LYS LYS A . n
A 1 13 ILE 13 65 65 ILE ILE A . n
A 1 14 PRO 14 66 66 PRO PRO A . n
A 1 15 ARG 15 67 67 ARG ARG A . n
A 1 16 ALA 16 68 68 ALA ALA A . n
A 1 17 LYS 17 69 69 LYS LYS A . n
A 1 18 ALA 18 70 70 ALA ALA A . n
A 1 19 GLU 19 71 71 GLU GLU A . n
A 1 20 GLU 20 72 72 GLU GLU A . n
A 1 21 MET 21 73 73 MET MET A . n
A 1 22 LEU 22 74 74 LEU LEU A . n
A 1 23 SER 23 75 75 SER SER A . n
A 1 24 LYS 24 76 76 LYS LYS A . n
A 1 25 GLN 25 77 77 GLN GLN A . n
A 1 26 ARG 26 78 78 ARG ARG A . n
A 1 27 HIS 27 79 79 HIS HIS A . n
A 1 28 ASP 28 80 80 ASP ASP A . n
A 1 29 GLY 29 81 81 GLY GLY A . n
A 1 30 ALA 30 82 82 ALA ALA A . n
A 1 31 PHE 31 83 83 PHE PHE A . n
A 1 32 LEU 32 84 84 LEU LEU A . n
A 1 33 ILE 33 85 85 ILE ILE A . n
A 1 34 ARG 34 86 86 ARG ARG A . n
A 1 35 GLU 35 87 87 GLU GLU A . n
A 1 36 SER 36 88 88 SER SER A . n
A 1 37 GLU 37 89 89 GLU GLU A . n
A 1 38 SER 38 90 90 SER SER A . n
A 1 39 ALA 39 91 91 ALA ALA A . n
A 1 40 PRO 40 92 92 PRO PRO A . n
A 1 41 GLY 41 93 93 GLY GLY A . n
A 1 42 ASP 42 94 94 ASP ASP A . n
A 1 43 PHE 43 95 95 PHE PHE A . n
A 1 44 SER 44 96 96 SER SER A . n
A 1 45 LEU 45 97 97 LEU LEU A . n
A 1 46 SER 46 98 98 SER SER A . n
A 1 47 VAL 47 99 99 VAL VAL A . n
A 1 48 LYS 48 100 100 LYS LYS A . n
A 1 49 PHE 49 101 101 PHE PHE A . n
A 1 50 GLY 50 102 102 GLY GLY A . n
A 1 51 ASN 51 103 103 ASN ASN A . n
A 1 52 ASP 52 104 104 ASP ASP A . n
A 1 53 VAL 53 105 105 VAL VAL A . n
A 1 54 GLN 54 106 106 GLN GLN A . n
A 1 55 HIS 55 107 107 HIS HIS A . n
A 1 56 PHE 56 108 108 PHE PHE A . n
A 1 57 LYS 57 109 109 LYS LYS A . n
A 1 58 VAL 58 110 110 VAL VAL A . n
A 1 59 LEU 59 111 111 LEU LEU A . n
A 1 60 ARG 60 112 112 ARG ARG A . n
A 1 61 ASP 61 113 113 ASP ASP A . n
A 1 62 GLY 62 114 114 GLY GLY A . n
A 1 63 ALA 63 115 115 ALA ALA A . n
A 1 64 GLY 64 116 116 GLY GLY A . n
A 1 65 LYS 65 117 117 LYS LYS A . n
A 1 66 TYR 66 118 118 TYR TYR A . n
A 1 67 PHE 67 119 119 PHE PHE A . n
A 1 68 LEU 68 120 120 LEU LEU A . n
A 1 69 TRP 69 121 121 TRP TRP A . n
A 1 70 VAL 70 122 122 VAL VAL A . n
A 1 71 VAL 71 123 123 VAL VAL A . n
A 1 72 LYS 72 124 124 LYS LYS A . n
A 1 73 PHE 73 125 125 PHE PHE A . n
A 1 74 ASN 74 126 126 ASN ASN A . n
A 1 75 SER 75 127 127 SER SER A . n
A 1 76 LEU 76 128 128 LEU LEU A . n
A 1 77 ASN 77 129 129 ASN ASN A . n
A 1 78 GLU 78 130 130 GLU GLU A . n
A 1 79 LEU 79 131 131 LEU LEU A . n
A 1 80 VAL 80 132 132 VAL VAL A . n
A 1 81 ASP 81 133 133 ASP ASP A . n
A 1 82 TYR 82 134 134 TYR TYR A . n
A 1 83 HIS 83 135 135 HIS HIS A . n
A 1 84 ARG 84 136 136 ARG ARG A . n
A 1 85 SER 85 137 137 SER SER A . n
A 1 86 THR 86 138 138 THR THR A . n
A 1 87 SER 87 139 139 SER SER A . n
A 1 88 VAL 88 140 140 VAL VAL A . n
A 1 89 SER 89 141 141 SER SER A . n
A 1 90 ARG 90 142 142 ARG ARG A . n
A 1 91 ASN 91 143 143 ASN ASN A . n
A 1 92 GLN 92 144 144 GLN GLN A . n
A 1 93 GLN 93 145 145 GLN GLN A . n
A 1 94 ILE 94 146 146 ILE ILE A . n
A 1 95 PHE 95 147 147 PHE PHE A . n
A 1 96 LEU 96 148 148 LEU LEU A . n
A 1 97 ARG 97 149 149 ARG ARG A . n
A 1 98 ASP 98 150 150 ASP ASP A . n
A 1 99 ILE 99 151 151 ILE ILE A . n
A 1 100 GLU 100 152 152 GLU GLU A . n
A 1 101 GLN 101 153 153 GLN GLN A . n
A 1 102 VAL 102 154 154 VAL VAL A . n
A 1 103 PRO 103 155 155 PRO PRO A . n
A 1 104 GLN 104 156 ? ? ? A . n
A 1 105 GLN 105 157 ? ? ? A . n
A 1 106 PRO 106 158 ? ? ? A . n
A 1 107 THR 107 159 ? ? ? A . n
A 1 108 TYR 108 160 ? ? ? A . n
A 1 109 VAL 109 161 ? ? ? A . n
A 1 110 GLN 110 162 ? ? ? A . n
A 1 111 HIS 111 163 ? ? ? A . n
A 1 112 HIS 112 164 ? ? ? A . n
A 1 113 HIS 113 165 ? ? ? A . n
A 1 114 HIS 114 166 ? ? ? A . n
A 1 115 HIS 115 167 ? ? ? A . n
A 1 116 HIS 116 168 ? ? ? A . n
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 YVN 1 202 202 YVN YVN A .
C 3 FMT 1 201 201 FMT FMT A .
D 4 HOH 1 203 1 HOH HOH A .
D 4 HOH 2 204 2 HOH HOH A .
D 4 HOH 3 205 3 HOH HOH A .
D 4 HOH 4 206 4 HOH HOH A .
D 4 HOH 5 207 5 HOH HOH A .
D 4 HOH 6 208 6 HOH HOH A .
D 4 HOH 7 209 7 HOH HOH A .
D 4 HOH 8 210 8 HOH HOH A .
D 4 HOH 9 211 9 HOH HOH A .
D 4 HOH 10 212 10 HOH HOH A .
D 4 HOH 11 213 11 HOH HOH A .
D 4 HOH 12 214 12 HOH HOH A .
D 4 HOH 13 215 13 HOH HOH A .
D 4 HOH 14 216 14 HOH HOH A .
D 4 HOH 15 217 15 HOH HOH A .
D 4 HOH 16 218 16 HOH HOH A .
D 4 HOH 17 219 17 HOH HOH A .
D 4 HOH 18 220 18 HOH HOH A .
D 4 HOH 19 221 19 HOH HOH A .
D 4 HOH 20 222 20 HOH HOH A .
D 4 HOH 21 223 21 HOH HOH A .
D 4 HOH 22 224 22 HOH HOH A .
D 4 HOH 23 225 23 HOH HOH A .
D 4 HOH 24 226 24 HOH HOH A .
D 4 HOH 25 227 25 HOH HOH A .
D 4 HOH 26 228 26 HOH HOH A .
D 4 HOH 27 229 27 HOH HOH A .
D 4 HOH 28 230 28 HOH HOH A .
D 4 HOH 29 231 29 HOH HOH A .
D 4 HOH 30 232 30 HOH HOH A .
D 4 HOH 31 233 31 HOH HOH A .
D 4 HOH 32 234 32 HOH HOH A .
D 4 HOH 33 235 33 HOH HOH A .
D 4 HOH 34 236 34 HOH HOH A .
D 4 HOH 35 237 35 HOH HOH A .
D 4 HOH 36 238 36 HOH HOH A .
D 4 HOH 37 239 37 HOH HOH A .
D 4 HOH 38 240 38 HOH HOH A .
D 4 HOH 39 241 39 HOH HOH A .
D 4 HOH 40 242 40 HOH HOH A .
D 4 HOH 41 243 41 HOH HOH A .
D 4 HOH 42 244 42 HOH HOH A .
D 4 HOH 43 245 43 HOH HOH A .
D 4 HOH 44 246 44 HOH HOH A .
D 4 HOH 45 247 45 HOH HOH A .
D 4 HOH 46 248 46 HOH HOH A .
D 4 HOH 47 249 47 HOH HOH A .
D 4 HOH 48 250 48 HOH HOH A .
D 4 HOH 49 251 49 HOH HOH A .
D 4 HOH 50 252 50 HOH HOH A .
D 4 HOH 51 253 51 HOH HOH A .
D 4 HOH 52 254 52 HOH HOH A .
D 4 HOH 53 255 53 HOH HOH A .
D 4 HOH 54 256 54 HOH HOH A .
D 4 HOH 55 257 55 HOH HOH A .
D 4 HOH 56 258 56 HOH HOH A .
D 4 HOH 57 259 57 HOH HOH A .
D 4 HOH 58 260 58 HOH HOH A .
D 4 HOH 59 261 59 HOH HOH A .
D 4 HOH 60 262 60 HOH HOH A .
D 4 HOH 61 263 61 HOH HOH A .
D 4 HOH 62 264 62 HOH HOH A .
D 4 HOH 63 265 63 HOH HOH A .
D 4 HOH 64 266 64 HOH HOH A .
D 4 HOH 65 267 65 HOH HOH A .
D 4 HOH 66 268 66 HOH HOH A .
D 4 HOH 67 269 67 HOH HOH A .
D 4 HOH 68 270 68 HOH HOH A .
D 4 HOH 69 271 69 HOH HOH A .
D 4 HOH 70 272 70 HOH HOH A .
D 4 HOH 71 273 71 HOH HOH A .
D 4 HOH 72 274 72 HOH HOH A .
D 4 HOH 73 275 73 HOH HOH A .
D 4 HOH 74 276 74 HOH HOH A .
D 4 HOH 75 277 75 HOH HOH A .
D 4 HOH 76 278 76 HOH HOH A .
D 4 HOH 77 279 77 HOH HOH A .
D 4 HOH 78 280 78 HOH HOH A .
D 4 HOH 79 281 79 HOH HOH A .
D 4 HOH 80 282 80 HOH HOH A .
D 4 HOH 81 283 81 HOH HOH A .
D 4 HOH 82 284 82 HOH HOH A .
D 4 HOH 83 285 83 HOH HOH A .
D 4 HOH 84 286 84 HOH HOH A .
D 4 HOH 85 287 85 HOH HOH A .
D 4 HOH 86 288 86 HOH HOH A .
D 4 HOH 87 289 87 HOH HOH A .
D 4 HOH 88 290 88 HOH HOH A .
D 4 HOH 89 291 89 HOH HOH A .
D 4 HOH 90 292 90 HOH HOH A .
D 4 HOH 91 293 91 HOH HOH A .
D 4 HOH 92 294 92 HOH HOH A .
D 4 HOH 93 295 93 HOH HOH A .
D 4 HOH 94 296 94 HOH HOH A .
D 4 HOH 95 297 95 HOH HOH A .
D 4 HOH 96 298 96 HOH HOH A .
D 4 HOH 97 299 97 HOH HOH A .
D 4 HOH 98 300 98 HOH HOH A .
D 4 HOH 99 301 99 HOH HOH A .
D 4 HOH 100 302 100 HOH HOH A .
D 4 HOH 101 303 101 HOH HOH A .
D 4 HOH 102 304 102 HOH HOH A .
D 4 HOH 103 305 103 HOH HOH A .
D 4 HOH 104 306 104 HOH HOH A .
D 4 HOH 105 307 105 HOH HOH A .
D 4 HOH 106 308 106 HOH HOH A .
D 4 HOH 107 309 107 HOH HOH A .
D 4 HOH 108 310 108 HOH HOH A .
D 4 HOH 109 311 109 HOH HOH A .
D 4 HOH 110 312 110 HOH HOH A .
D 4 HOH 111 313 111 HOH HOH A .
D 4 HOH 112 314 113 HOH HOH A .
D 4 HOH 113 315 114 HOH HOH A .
D 4 HOH 114 316 115 HOH HOH A .
D 4 HOH 115 317 116 HOH HOH A .
D 4 HOH 116 318 117 HOH HOH A .
D 4 HOH 117 319 118 HOH HOH A .
D 4 HOH 118 320 119 HOH HOH A .
D 4 HOH 119 321 120 HOH HOH A .
D 4 HOH 120 322 121 HOH HOH A .
D 4 HOH 121 323 122 HOH HOH A .
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_defined_assembly
_pdbx_struct_assembly.method_details ?
_pdbx_struct_assembly.oligomeric_details monomeric
_pdbx_struct_assembly.oligomeric_count 1
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B,C,D
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2006-08-15
2 'Structure model' 1 1 2008-08-12
#
loop_
_pdbx_audit_revision_details.ordinal
_pdbx_audit_revision_details.revision_ordinal
_pdbx_audit_revision_details.data_content_type
_pdbx_audit_revision_details.provider
_pdbx_audit_revision_details.type
_pdbx_audit_revision_details.description
1 1 'Structure model' repository 'Initial release' ?
2 2 'Structure model' repository Obsolete ?
#
loop_
_software.name
_software.version
_software.date
_software.type
_software.contact_author
_software.contact_author_email
_software.classification
_software.location
_software.language
_software.citation_id
_software.pdbx_ordinal
HKL . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data processing'
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1
CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement
http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 2
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction'
http://pdb.rutgers.edu/software/ C++ ? 3
HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4
HKL . ? ? ? ? 'data scaling' ? ? ? 5
CCP4 . ? ? ? ? phasing ? ? ? 6
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 TRP A 121 ? ? -123.59 -69.89
2 1 VAL A 122 ? ? -130.23 -50.39
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A ILE 53 ? A ILE 1
2 1 Y 1 A GLU 54 ? A GLU 2
3 1 Y 1 A GLN 156 ? A GLN 104
4 1 Y 1 A GLN 157 ? A GLN 105
5 1 Y 1 A PRO 158 ? A PRO 106
6 1 Y 1 A THR 159 ? A THR 107
7 1 Y 1 A TYR 160 ? A TYR 108
8 1 Y 1 A VAL 161 ? A VAL 109
9 1 Y 1 A GLN 162 ? A GLN 110
10 1 Y 1 A HIS 163 ? A HIS 111
11 1 Y 1 A HIS 164 ? A HIS 112
12 1 Y 1 A HIS 165 ? A HIS 113
13 1 Y 1 A HIS 166 ? A HIS 114
14 1 Y 1 A HIS 167 ? A HIS 115
15 1 Y 1 A HIS 168 ? A HIS 116
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2 'N-({(1R,2R,3S)-2-(methylcarbamoyl)-3-[4-(phosphonooxy)phenyl]cyclopropyl}carbonyl)-L-valyl-L-aspartamide' YVN
3 'FORMIC ACID' FMT
4 water HOH
#