data_2HZD # _entry.id 2HZD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HZD pdb_00002hzd 10.2210/pdb2hzd/pdb RCSB RCSB038942 ? ? WWPDB D_1000038942 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HZD _pdbx_database_status.recvd_initial_deposition_date 2006-08-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Anbanandam, A.' 1 'Veeraraghavan, S.' 2 # _citation.id primary _citation.title 'Insights into transcription enhancer factor 1 (TEF-1) activity from the solution structure of the TEA domain.' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 103 _citation.page_first 17225 _citation.page_last 17230 _citation.year 2006 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17085591 _citation.pdbx_database_id_DOI 10.1073/pnas.0607171103 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Anbanandam, A.' 1 ? primary 'Albarado, D.C.' 2 ? primary 'Nguyen, C.T.' 3 ? primary 'Halder, G.' 4 ? primary 'Gao, X.' 5 ? primary 'Veeraraghavan, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcriptional enhancer factor TEF-1' _entity.formula_weight 9548.997 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL TEA DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TEA domain family member 1, TEAD-1, Protein GT-IIC, Transcription factor 13, NTEF-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDNDAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDLV PR ; _entity_poly.pdbx_seq_one_letter_code_can ;MDNDAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDLV PR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASN n 1 4 ASP n 1 5 ALA n 1 6 GLU n 1 7 GLY n 1 8 VAL n 1 9 TRP n 1 10 SER n 1 11 PRO n 1 12 ASP n 1 13 ILE n 1 14 GLU n 1 15 GLN n 1 16 SER n 1 17 PHE n 1 18 GLN n 1 19 GLU n 1 20 ALA n 1 21 LEU n 1 22 SER n 1 23 ILE n 1 24 TYR n 1 25 PRO n 1 26 PRO n 1 27 CYS n 1 28 GLY n 1 29 ARG n 1 30 ARG n 1 31 LYS n 1 32 ILE n 1 33 ILE n 1 34 LEU n 1 35 SER n 1 36 ASP n 1 37 GLU n 1 38 GLY n 1 39 LYS n 1 40 MET n 1 41 TYR n 1 42 GLY n 1 43 ARG n 1 44 ASN n 1 45 GLU n 1 46 LEU n 1 47 ILE n 1 48 ALA n 1 49 ARG n 1 50 TYR n 1 51 ILE n 1 52 LYS n 1 53 LEU n 1 54 ARG n 1 55 THR n 1 56 GLY n 1 57 LYS n 1 58 THR n 1 59 ARG n 1 60 THR n 1 61 ARG n 1 62 LYS n 1 63 GLN n 1 64 VAL n 1 65 SER n 1 66 SER n 1 67 HIS n 1 68 ILE n 1 69 GLN n 1 70 VAL n 1 71 LEU n 1 72 ALA n 1 73 ARG n 1 74 ARG n 1 75 LYS n 1 76 SER n 1 77 ARG n 1 78 ASP n 1 79 LEU n 1 80 VAL n 1 81 PRO n 1 82 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'TEAD1, TCF13, TEF1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET21D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TEAD1_HUMAN _struct_ref.pdbx_db_accession P28347 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code IDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRD _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HZD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28347 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 78 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HZD MET A 1 ? UNP P28347 ? ? 'initiating methionine' 1 1 1 2HZD SER A 22 ? UNP P28347 ALA 48 conflict 22 2 1 2HZD LEU A 79 ? UNP P28347 ? ? 'cloning artifact' 79 3 1 2HZD VAL A 80 ? UNP P28347 ? ? 'cloning artifact' 80 4 1 2HZD PRO A 81 ? UNP P28347 ? ? 'cloning artifact' 81 5 1 2HZD ARG A 82 ? UNP P28347 ? ? 'cloning artifact' 82 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.85 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.3 mM TEA U-15N, 13C, 100 mM phosphate buffer, 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '100 mM phosphate buffer, 95% H2O, 5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 AVANCE Bruker 800 ? # _pdbx_nmr_refine.entry_id 2HZD _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2HZD _pdbx_nmr_details.text '3D TRIPLE RESONANCE EXPERIMENTS' # _pdbx_nmr_ensemble.entry_id 2HZD _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2HZD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version 1.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 2HZD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2HZD _struct.title 'NMR structure of the DNA-binding TEA domain and insights into TEF-1 function' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HZD _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'DNA-BINDING, HELIX-TURN-HELIX, GENE REGULATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? GLU A 6 ? ASP A 2 GLU A 6 5 ? 5 HELX_P HELX_P2 2 SER A 10 ? TYR A 24 ? SER A 10 TYR A 24 1 ? 15 HELX_P HELX_P3 3 ILE A 33 ? GLY A 38 ? ILE A 33 GLY A 38 1 ? 6 HELX_P HELX_P4 4 ARG A 43 ? GLY A 56 ? ARG A 43 GLY A 56 1 ? 14 HELX_P HELX_P5 5 ARG A 61 ? SER A 76 ? ARG A 61 SER A 76 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2HZD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2HZD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ARG 82 82 82 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-24 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 32 ? ? -160.05 84.65 2 1 ASP A 36 ? ? -97.99 -65.94 3 1 TYR A 41 ? ? -69.37 -175.34 4 1 THR A 55 ? ? -162.10 30.57 5 1 THR A 58 ? ? -47.82 170.24 6 1 ARG A 59 ? ? -155.41 66.83 7 1 LEU A 79 ? ? -64.63 95.68 8 1 VAL A 80 ? ? -58.70 109.38 9 2 ASP A 2 ? ? -61.31 92.50 10 2 ARG A 29 ? ? -59.80 99.61 11 2 ARG A 30 ? ? -59.72 -172.86 12 2 ASP A 36 ? ? -125.07 -69.60 13 2 THR A 55 ? ? -163.15 29.88 14 2 THR A 58 ? ? -47.97 170.20 15 2 ARG A 59 ? ? -155.42 66.85 16 2 LEU A 79 ? ? -61.33 87.00 17 3 ARG A 29 ? ? -58.85 92.93 18 3 ASP A 36 ? ? -125.03 -69.67 19 3 THR A 55 ? ? -163.17 29.91 20 3 THR A 58 ? ? -47.94 170.03 21 3 ARG A 59 ? ? -155.31 66.92 22 3 LEU A 79 ? ? -65.99 77.35 23 3 PRO A 81 ? ? -66.75 76.14 24 4 ASP A 2 ? ? -61.77 92.05 25 4 CYS A 27 ? ? -62.12 88.66 26 4 ARG A 29 ? ? -59.02 98.81 27 4 ILE A 32 ? ? -163.71 114.72 28 4 ILE A 33 ? ? -164.26 109.72 29 4 ASP A 36 ? ? -125.21 -70.49 30 4 LYS A 57 ? ? -171.83 87.56 31 4 ARG A 59 ? ? -155.22 66.60 32 4 LEU A 79 ? ? -64.28 81.05 33 4 PRO A 81 ? ? -67.75 96.17 34 5 ARG A 30 ? ? -59.15 -178.77 35 5 LYS A 31 ? ? -59.59 -176.34 36 5 LYS A 57 ? ? -167.76 87.50 37 5 ARG A 59 ? ? -155.71 66.85 38 5 LEU A 79 ? ? -60.69 86.23 39 6 SER A 10 ? ? -56.83 108.90 40 6 ARG A 29 ? ? -62.28 -170.91 41 6 ASP A 36 ? ? -105.40 -70.98 42 6 LYS A 57 ? ? -167.83 87.42 43 6 ARG A 59 ? ? -155.00 66.42 44 6 LEU A 79 ? ? -66.45 76.51 45 6 PRO A 81 ? ? -68.83 63.40 46 7 SER A 10 ? ? -58.68 109.31 47 7 TYR A 24 ? ? -104.72 75.54 48 7 PRO A 25 ? ? -56.40 174.08 49 7 LYS A 31 ? ? -60.30 -171.93 50 7 THR A 58 ? ? -47.07 169.41 51 7 ARG A 59 ? ? -154.06 66.90 52 7 LEU A 79 ? ? -65.27 78.11 53 7 PRO A 81 ? ? -68.73 63.35 54 8 ASP A 2 ? ? -61.09 88.47 55 8 TYR A 24 ? ? -104.91 75.77 56 8 THR A 55 ? ? -163.12 30.59 57 8 THR A 58 ? ? -47.81 168.58 58 8 ARG A 59 ? ? -155.43 66.89 59 9 TYR A 24 ? ? -119.07 79.59 60 9 ARG A 30 ? ? -58.61 -172.58 61 9 LYS A 31 ? ? -49.83 106.79 62 9 LEU A 34 ? ? -81.98 34.39 63 9 THR A 55 ? ? -163.21 28.09 64 9 THR A 58 ? ? -57.11 170.31 65 9 ARG A 59 ? ? -155.51 67.06 66 9 LEU A 79 ? ? -62.57 83.26 67 9 PRO A 81 ? ? -67.17 99.72 68 10 ASP A 2 ? ? -60.97 99.16 69 10 TRP A 9 ? ? -61.07 97.91 70 10 ILE A 32 ? ? -69.70 -179.37 71 10 ILE A 33 ? ? -171.93 126.80 72 10 ASP A 36 ? ? -116.72 -74.10 73 10 TYR A 41 ? ? -69.95 -175.90 74 10 THR A 58 ? ? -47.28 163.38 75 10 ARG A 59 ? ? -155.62 67.02 76 10 LEU A 79 ? ? -56.10 90.68 77 11 ARG A 29 ? ? -59.34 92.93 78 11 ARG A 30 ? ? -62.26 -178.24 79 11 LEU A 34 ? ? -98.51 30.21 80 11 ASP A 36 ? ? -125.22 -55.27 81 11 LYS A 57 ? ? -167.96 87.44 82 11 ARG A 59 ? ? -155.22 66.58 83 11 LEU A 79 ? ? -62.56 83.52 84 12 ASP A 2 ? ? -60.17 87.21 85 12 ILE A 32 ? ? -165.31 112.40 86 12 ASP A 36 ? ? -125.15 -73.97 87 12 THR A 58 ? ? -47.49 165.78 88 12 ARG A 59 ? ? -155.91 67.31 89 12 THR A 60 ? ? -46.27 154.63 90 12 LEU A 79 ? ? -68.72 69.96 91 12 PRO A 81 ? ? -68.83 63.44 92 13 TRP A 9 ? ? -58.48 102.10 93 13 TYR A 24 ? ? -108.56 76.70 94 13 PRO A 25 ? ? -47.52 176.50 95 13 ARG A 29 ? ? -58.33 -166.61 96 13 ARG A 30 ? ? -44.04 151.12 97 13 LYS A 57 ? ? -168.22 87.47 98 13 ARG A 59 ? ? -154.99 66.47 99 13 LEU A 79 ? ? -64.05 81.16 100 14 TYR A 41 ? ? -155.62 83.75 101 14 ARG A 43 ? ? -77.92 -70.12 102 14 LYS A 57 ? ? -164.58 89.62 103 14 ARG A 59 ? ? -155.58 66.69 104 14 LEU A 79 ? ? -66.16 77.37 105 15 ASP A 36 ? ? -80.75 -70.09 106 15 LYS A 57 ? ? -162.73 87.69 107 15 ARG A 59 ? ? -155.30 66.58 108 15 LEU A 79 ? ? -62.88 82.77 109 15 PRO A 81 ? ? -68.30 91.43 110 16 CYS A 27 ? ? -64.27 90.46 111 16 ASP A 36 ? ? -125.03 -61.24 112 16 THR A 55 ? ? -163.15 29.58 113 16 THR A 58 ? ? -47.88 167.51 114 16 ARG A 59 ? ? -155.51 66.72 115 16 LEU A 79 ? ? -68.55 71.98 116 17 ARG A 29 ? ? -64.08 92.92 117 17 LYS A 31 ? ? -64.03 94.79 118 17 SER A 35 ? ? -122.89 -82.05 119 17 TYR A 41 ? ? -69.67 83.76 120 17 LYS A 57 ? ? -168.35 87.44 121 17 ARG A 59 ? ? -154.94 66.64 122 17 VAL A 80 ? ? -58.51 109.32 123 18 ASP A 2 ? ? -61.09 89.05 124 18 TRP A 9 ? ? -61.82 -179.26 125 18 LYS A 31 ? ? -61.12 94.95 126 18 ILE A 33 ? ? -159.27 87.04 127 18 SER A 35 ? ? -122.30 -80.54 128 18 TYR A 41 ? ? -69.92 83.83 129 18 ARG A 59 ? ? -155.49 66.37 130 18 LEU A 79 ? ? -63.90 81.34 131 19 LYS A 31 ? ? -63.58 94.80 132 19 ILE A 33 ? ? -175.10 122.91 133 19 LEU A 34 ? ? -95.21 34.40 134 19 LYS A 57 ? ? -168.46 87.69 135 19 ARG A 59 ? ? -155.76 67.00 136 20 SER A 10 ? ? -57.77 109.04 137 20 ARG A 29 ? ? -63.35 92.95 138 20 ASP A 36 ? ? -125.28 -65.95 139 20 THR A 58 ? ? -48.69 170.08 140 20 ARG A 59 ? ? -155.65 66.91 141 20 ASP A 78 ? ? -131.29 -45.48 142 21 ASP A 2 ? ? -62.18 84.78 143 21 TRP A 9 ? ? -58.39 97.82 144 21 TYR A 41 ? ? -69.43 -175.47 145 21 LYS A 57 ? ? -167.17 87.88 146 21 ARG A 59 ? ? -155.73 67.02 147 21 LEU A 79 ? ? -65.52 77.70 148 22 VAL A 8 ? ? -128.56 -80.35 149 22 ILE A 33 ? ? -169.24 79.62 150 22 TYR A 41 ? ? -69.90 -177.08 151 22 LYS A 57 ? ? -168.31 87.51 152 22 ARG A 59 ? ? -154.92 66.41 153 22 LEU A 79 ? ? -61.55 85.42 154 23 ILE A 32 ? ? -166.34 116.80 155 23 ASP A 36 ? ? -105.10 -60.77 156 23 TYR A 41 ? ? -69.70 -175.64 157 23 THR A 58 ? ? -47.08 166.36 158 23 ARG A 59 ? ? -155.38 66.95 159 23 ASP A 78 ? ? -97.17 30.03 160 23 LEU A 79 ? ? -60.45 94.10 161 24 ASP A 2 ? ? -60.10 -179.99 162 24 TYR A 24 ? ? -114.12 76.87 163 24 CYS A 27 ? ? -161.38 74.00 164 24 ARG A 30 ? ? -64.12 86.86 165 24 ASP A 36 ? ? -101.82 -63.84 166 24 THR A 55 ? ? -163.52 -39.70 167 24 THR A 58 ? ? -47.54 170.12 168 24 ARG A 59 ? ? -155.59 66.87 169 24 ASP A 78 ? ? -94.42 30.33 170 24 LEU A 79 ? ? -64.94 79.98 171 24 VAL A 80 ? ? -59.12 109.58 172 24 PRO A 81 ? ? -68.29 94.99 173 25 ASP A 4 ? ? -119.24 -79.48 174 25 CYS A 27 ? ? -59.93 88.48 175 25 ARG A 30 ? ? -59.78 96.37 176 25 LYS A 31 ? ? -61.48 94.94 177 25 ASP A 36 ? ? -125.15 -60.27 178 25 LYS A 57 ? ? -167.38 87.56 179 25 ARG A 59 ? ? -155.19 66.74 180 25 VAL A 80 ? ? -58.15 108.99 181 25 PRO A 81 ? ? -69.09 63.38 #