data_2I1T # _entry.id 2I1T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2I1T pdb_00002i1t 10.2210/pdb2i1t/pdb RCSB RCSB039029 ? ? WWPDB D_1000039029 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-29 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.entry_id 2I1T _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2006-08-15 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liao, Z.' 1 'Peng, K.' 2 'Liang, S.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of Jingzhaotoxin-III, a novel toxin inhibiting both Nav and Kv channels' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Jingzhaotoxin-III, a novel spider toxin inhibiting activation of voltage-gated sodium channel in rat cardiac myocytes' J.Biol.Chem. 279 26220 26226 2004 JBCHA3 US 0021-9258 0071 ? 15084603 10.1074/jbc.M401387200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liao, Z.' 1 ? primary 'Peng, K.' 2 ? primary 'Liang, S.' 3 ? 1 'Xiao, Y.' 4 ? 1 'Tang, J.' 5 ? 1 'Yang, Y.' 6 ? 1 'Wang, M.' 7 ? 1 'Hu, W.' 8 ? 1 'Xie, J.' 9 ? 1 'Zeng, X.' 10 ? 1 'Liang, S.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description Jingzhaotoxin-3 _entity.formula_weight 3930.539 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Jingzhaotoxin-III, JZTX-III' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP _entity_poly.pdbx_seq_one_letter_code_can DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 GLY n 1 3 GLU n 1 4 CYS n 1 5 GLY n 1 6 GLY n 1 7 PHE n 1 8 TRP n 1 9 TRP n 1 10 LYS n 1 11 CYS n 1 12 GLY n 1 13 ARG n 1 14 GLY n 1 15 LYS n 1 16 PRO n 1 17 PRO n 1 18 CYS n 1 19 CYS n 1 20 LYS n 1 21 GLY n 1 22 TYR n 1 23 ALA n 1 24 CYS n 1 25 SER n 1 26 LYS n 1 27 THR n 1 28 TRP n 1 29 GLY n 1 30 TRP n 1 31 CYS n 1 32 ALA n 1 33 VAL n 1 34 GLU n 1 35 ALA n 1 36 PRO n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Chilobrachys jingzhao' _entity_src_nat.pdbx_ncbi_taxonomy_id 278060 _entity_src_nat.genus Chilobrachys _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion venom _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PRO 36 36 36 PRO PRO A . n # _exptl.entry_id 2I1T _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2I1T _struct.title 'Solution structure of Jingzhaotoxin-III, a novel toxin inhibiting both Nav and Kv channels' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2I1T _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Jingzhaotoxin-III, Kv2.1 channel, Nav channel, cardiac myocytes, solution structure, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code JZTX3_CHIJI _struct_ref.pdbx_db_accession P62520 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2I1T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62520 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 63 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 4 A CYS 19 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 11 A CYS 24 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf3 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 18 A CYS 31 1_555 ? ? ? ? ? ? ? 2.018 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 19 ? CYS A 4 ? 1_555 CYS A 19 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 11 ? CYS A 24 ? CYS A 11 ? 1_555 CYS A 24 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 18 ? CYS A 31 ? CYS A 18 ? 1_555 CYS A 31 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 9 ? LYS A 10 ? TRP A 9 LYS A 10 A 2 TRP A 30 ? VAL A 33 ? TRP A 30 VAL A 33 A 3 TYR A 22 ? SER A 25 ? TYR A 22 SER A 25 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 9 ? N TRP A 9 O CYS A 31 ? O CYS A 31 A 2 3 O ALA A 32 ? O ALA A 32 N ALA A 23 ? N ALA A 23 # _pdbx_entry_details.entry_id 2I1T _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 15 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TRP _pdbx_validate_close_contact.auth_seq_id_1 9 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 31 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 GLU A 3 ? ? -145.20 50.92 2 2 TRP A 8 ? ? -153.83 69.97 3 2 ARG A 13 ? ? -90.71 37.37 4 2 GLU A 34 ? ? -94.23 52.23 5 3 TRP A 8 ? ? -161.85 65.01 6 3 ARG A 13 ? ? -90.45 55.02 7 4 GLU A 3 ? ? -115.91 -168.42 8 4 TRP A 8 ? ? -156.59 69.44 9 6 GLU A 3 ? ? 55.02 87.77 10 6 ARG A 13 ? ? -90.93 38.36 11 7 TRP A 8 ? ? -153.65 72.80 12 8 ALA A 35 ? ? 54.06 86.56 13 9 ARG A 13 ? ? -90.51 54.16 14 10 ARG A 13 ? ? -90.73 41.48 15 11 GLU A 3 ? ? -107.17 57.61 16 11 ARG A 13 ? ? -90.86 34.04 17 11 GLU A 34 ? ? -62.17 -85.88 18 11 ALA A 35 ? ? -170.56 136.23 19 12 ALA A 35 ? ? 57.42 81.78 20 13 TRP A 8 ? ? -154.44 72.59 21 13 ARG A 13 ? ? -90.40 50.82 22 13 LYS A 20 ? ? -52.99 109.13 23 16 ARG A 13 ? ? -90.59 38.08 24 18 TRP A 8 ? ? -151.06 68.69 25 18 ARG A 13 ? ? -90.72 53.39 26 18 GLU A 34 ? ? -94.97 34.06 27 19 TRP A 8 ? ? -160.06 68.06 28 19 ARG A 13 ? ? -90.78 43.01 29 19 GLU A 34 ? ? -54.98 102.04 30 20 GLU A 3 ? ? -159.31 85.92 31 20 ARG A 13 ? ? -91.15 31.24 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 13 ? ? 0.317 'SIDE CHAIN' 2 2 ARG A 13 ? ? 0.318 'SIDE CHAIN' 3 3 ARG A 13 ? ? 0.296 'SIDE CHAIN' 4 4 ARG A 13 ? ? 0.294 'SIDE CHAIN' 5 5 ARG A 13 ? ? 0.317 'SIDE CHAIN' 6 6 ARG A 13 ? ? 0.312 'SIDE CHAIN' 7 7 ARG A 13 ? ? 0.295 'SIDE CHAIN' 8 8 ARG A 13 ? ? 0.315 'SIDE CHAIN' 9 9 ARG A 13 ? ? 0.297 'SIDE CHAIN' 10 10 ARG A 13 ? ? 0.316 'SIDE CHAIN' 11 11 ARG A 13 ? ? 0.316 'SIDE CHAIN' 12 12 ARG A 13 ? ? 0.317 'SIDE CHAIN' 13 13 ARG A 13 ? ? 0.293 'SIDE CHAIN' 14 14 ARG A 13 ? ? 0.269 'SIDE CHAIN' 15 15 ARG A 13 ? ? 0.298 'SIDE CHAIN' 16 16 ARG A 13 ? ? 0.300 'SIDE CHAIN' 17 17 ARG A 13 ? ? 0.291 'SIDE CHAIN' 18 18 ARG A 13 ? ? 0.307 'SIDE CHAIN' 19 19 ARG A 13 ? ? 0.277 'SIDE CHAIN' 20 20 ARG A 13 ? ? 0.261 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 2I1T _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2I1T _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;6mM Jingzhaotoxin-III, 20mM deuterium sodium acetate buffer, 0.002% NaN3, 0.01mM EDTA, 0.2mM Sodium 3-(trimethylsilyl) propionate-2,2,3,3-d4, pH 4.0, 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 1 1 '2D TOCSY' 3 1 1 '2D NOESY' # _pdbx_nmr_details.entry_id 2I1T _pdbx_nmr_details.text ;TOCSY spectra were obtained with a mixing time of 85 ms. NOESY spectra were recorded in D2O with a mixing time of 200 ms and in H2O with mixing times of 100, 200, and 400 ms. All two-dimensional measurements were recorded with 1024-512 frequency data points and were zero-filled to yield 2048-1024 data matrices except for the high resolution DQF-COSY spectrum. The DQF-COSY spectrum was recorded with 2048-1024 data points in the t2 and t1 dimensions, respectively, and zero-filled to 4096 - 2048 points to measure the coupling constants. ; # _pdbx_nmr_refine.entry_id 2I1T _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ;Structural calculations were performed on 395 interproton distance constraints derived from the 2D NOESY spectra, 13 dihedral angle constraints derived from the coupling constant (DQF-COSY) and NOE measurements, eight hydrogen-bond restraints derived from the hydrogen-deuterium exchange experiments, and nine disulfide bond restraints, giving a total of 425 restraints. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 'NIH 2.9.6' refinement 'Brunger A. T. etall' 1 Felix 98.0 'data analysis' 'Biosym Technologies' 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLU N N N N 71 GLU CA C N S 72 GLU C C N N 73 GLU O O N N 74 GLU CB C N N 75 GLU CG C N N 76 GLU CD C N N 77 GLU OE1 O N N 78 GLU OE2 O N N 79 GLU OXT O N N 80 GLU H H N N 81 GLU H2 H N N 82 GLU HA H N N 83 GLU HB2 H N N 84 GLU HB3 H N N 85 GLU HG2 H N N 86 GLU HG3 H N N 87 GLU HE2 H N N 88 GLU HXT H N N 89 GLY N N N N 90 GLY CA C N N 91 GLY C C N N 92 GLY O O N N 93 GLY OXT O N N 94 GLY H H N N 95 GLY H2 H N N 96 GLY HA2 H N N 97 GLY HA3 H N N 98 GLY HXT H N N 99 LYS N N N N 100 LYS CA C N S 101 LYS C C N N 102 LYS O O N N 103 LYS CB C N N 104 LYS CG C N N 105 LYS CD C N N 106 LYS CE C N N 107 LYS NZ N N N 108 LYS OXT O N N 109 LYS H H N N 110 LYS H2 H N N 111 LYS HA H N N 112 LYS HB2 H N N 113 LYS HB3 H N N 114 LYS HG2 H N N 115 LYS HG3 H N N 116 LYS HD2 H N N 117 LYS HD3 H N N 118 LYS HE2 H N N 119 LYS HE3 H N N 120 LYS HZ1 H N N 121 LYS HZ2 H N N 122 LYS HZ3 H N N 123 LYS HXT H N N 124 PHE N N N N 125 PHE CA C N S 126 PHE C C N N 127 PHE O O N N 128 PHE CB C N N 129 PHE CG C Y N 130 PHE CD1 C Y N 131 PHE CD2 C Y N 132 PHE CE1 C Y N 133 PHE CE2 C Y N 134 PHE CZ C Y N 135 PHE OXT O N N 136 PHE H H N N 137 PHE H2 H N N 138 PHE HA H N N 139 PHE HB2 H N N 140 PHE HB3 H N N 141 PHE HD1 H N N 142 PHE HD2 H N N 143 PHE HE1 H N N 144 PHE HE2 H N N 145 PHE HZ H N N 146 PHE HXT H N N 147 PRO N N N N 148 PRO CA C N S 149 PRO C C N N 150 PRO O O N N 151 PRO CB C N N 152 PRO CG C N N 153 PRO CD C N N 154 PRO OXT O N N 155 PRO H H N N 156 PRO HA H N N 157 PRO HB2 H N N 158 PRO HB3 H N N 159 PRO HG2 H N N 160 PRO HG3 H N N 161 PRO HD2 H N N 162 PRO HD3 H N N 163 PRO HXT H N N 164 SER N N N N 165 SER CA C N S 166 SER C C N N 167 SER O O N N 168 SER CB C N N 169 SER OG O N N 170 SER OXT O N N 171 SER H H N N 172 SER H2 H N N 173 SER HA H N N 174 SER HB2 H N N 175 SER HB3 H N N 176 SER HG H N N 177 SER HXT H N N 178 THR N N N N 179 THR CA C N S 180 THR C C N N 181 THR O O N N 182 THR CB C N R 183 THR OG1 O N N 184 THR CG2 C N N 185 THR OXT O N N 186 THR H H N N 187 THR H2 H N N 188 THR HA H N N 189 THR HB H N N 190 THR HG1 H N N 191 THR HG21 H N N 192 THR HG22 H N N 193 THR HG23 H N N 194 THR HXT H N N 195 TRP N N N N 196 TRP CA C N S 197 TRP C C N N 198 TRP O O N N 199 TRP CB C N N 200 TRP CG C Y N 201 TRP CD1 C Y N 202 TRP CD2 C Y N 203 TRP NE1 N Y N 204 TRP CE2 C Y N 205 TRP CE3 C Y N 206 TRP CZ2 C Y N 207 TRP CZ3 C Y N 208 TRP CH2 C Y N 209 TRP OXT O N N 210 TRP H H N N 211 TRP H2 H N N 212 TRP HA H N N 213 TRP HB2 H N N 214 TRP HB3 H N N 215 TRP HD1 H N N 216 TRP HE1 H N N 217 TRP HE3 H N N 218 TRP HZ2 H N N 219 TRP HZ3 H N N 220 TRP HH2 H N N 221 TRP HXT H N N 222 TYR N N N N 223 TYR CA C N S 224 TYR C C N N 225 TYR O O N N 226 TYR CB C N N 227 TYR CG C Y N 228 TYR CD1 C Y N 229 TYR CD2 C Y N 230 TYR CE1 C Y N 231 TYR CE2 C Y N 232 TYR CZ C Y N 233 TYR OH O N N 234 TYR OXT O N N 235 TYR H H N N 236 TYR H2 H N N 237 TYR HA H N N 238 TYR HB2 H N N 239 TYR HB3 H N N 240 TYR HD1 H N N 241 TYR HD2 H N N 242 TYR HE1 H N N 243 TYR HE2 H N N 244 TYR HH H N N 245 TYR HXT H N N 246 VAL N N N N 247 VAL CA C N S 248 VAL C C N N 249 VAL O O N N 250 VAL CB C N N 251 VAL CG1 C N N 252 VAL CG2 C N N 253 VAL OXT O N N 254 VAL H H N N 255 VAL H2 H N N 256 VAL HA H N N 257 VAL HB H N N 258 VAL HG11 H N N 259 VAL HG12 H N N 260 VAL HG13 H N N 261 VAL HG21 H N N 262 VAL HG22 H N N 263 VAL HG23 H N N 264 VAL HXT H N N 265 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLU N CA sing N N 67 GLU N H sing N N 68 GLU N H2 sing N N 69 GLU CA C sing N N 70 GLU CA CB sing N N 71 GLU CA HA sing N N 72 GLU C O doub N N 73 GLU C OXT sing N N 74 GLU CB CG sing N N 75 GLU CB HB2 sing N N 76 GLU CB HB3 sing N N 77 GLU CG CD sing N N 78 GLU CG HG2 sing N N 79 GLU CG HG3 sing N N 80 GLU CD OE1 doub N N 81 GLU CD OE2 sing N N 82 GLU OE2 HE2 sing N N 83 GLU OXT HXT sing N N 84 GLY N CA sing N N 85 GLY N H sing N N 86 GLY N H2 sing N N 87 GLY CA C sing N N 88 GLY CA HA2 sing N N 89 GLY CA HA3 sing N N 90 GLY C O doub N N 91 GLY C OXT sing N N 92 GLY OXT HXT sing N N 93 LYS N CA sing N N 94 LYS N H sing N N 95 LYS N H2 sing N N 96 LYS CA C sing N N 97 LYS CA CB sing N N 98 LYS CA HA sing N N 99 LYS C O doub N N 100 LYS C OXT sing N N 101 LYS CB CG sing N N 102 LYS CB HB2 sing N N 103 LYS CB HB3 sing N N 104 LYS CG CD sing N N 105 LYS CG HG2 sing N N 106 LYS CG HG3 sing N N 107 LYS CD CE sing N N 108 LYS CD HD2 sing N N 109 LYS CD HD3 sing N N 110 LYS CE NZ sing N N 111 LYS CE HE2 sing N N 112 LYS CE HE3 sing N N 113 LYS NZ HZ1 sing N N 114 LYS NZ HZ2 sing N N 115 LYS NZ HZ3 sing N N 116 LYS OXT HXT sing N N 117 PHE N CA sing N N 118 PHE N H sing N N 119 PHE N H2 sing N N 120 PHE CA C sing N N 121 PHE CA CB sing N N 122 PHE CA HA sing N N 123 PHE C O doub N N 124 PHE C OXT sing N N 125 PHE CB CG sing N N 126 PHE CB HB2 sing N N 127 PHE CB HB3 sing N N 128 PHE CG CD1 doub Y N 129 PHE CG CD2 sing Y N 130 PHE CD1 CE1 sing Y N 131 PHE CD1 HD1 sing N N 132 PHE CD2 CE2 doub Y N 133 PHE CD2 HD2 sing N N 134 PHE CE1 CZ doub Y N 135 PHE CE1 HE1 sing N N 136 PHE CE2 CZ sing Y N 137 PHE CE2 HE2 sing N N 138 PHE CZ HZ sing N N 139 PHE OXT HXT sing N N 140 PRO N CA sing N N 141 PRO N CD sing N N 142 PRO N H sing N N 143 PRO CA C sing N N 144 PRO CA CB sing N N 145 PRO CA HA sing N N 146 PRO C O doub N N 147 PRO C OXT sing N N 148 PRO CB CG sing N N 149 PRO CB HB2 sing N N 150 PRO CB HB3 sing N N 151 PRO CG CD sing N N 152 PRO CG HG2 sing N N 153 PRO CG HG3 sing N N 154 PRO CD HD2 sing N N 155 PRO CD HD3 sing N N 156 PRO OXT HXT sing N N 157 SER N CA sing N N 158 SER N H sing N N 159 SER N H2 sing N N 160 SER CA C sing N N 161 SER CA CB sing N N 162 SER CA HA sing N N 163 SER C O doub N N 164 SER C OXT sing N N 165 SER CB OG sing N N 166 SER CB HB2 sing N N 167 SER CB HB3 sing N N 168 SER OG HG sing N N 169 SER OXT HXT sing N N 170 THR N CA sing N N 171 THR N H sing N N 172 THR N H2 sing N N 173 THR CA C sing N N 174 THR CA CB sing N N 175 THR CA HA sing N N 176 THR C O doub N N 177 THR C OXT sing N N 178 THR CB OG1 sing N N 179 THR CB CG2 sing N N 180 THR CB HB sing N N 181 THR OG1 HG1 sing N N 182 THR CG2 HG21 sing N N 183 THR CG2 HG22 sing N N 184 THR CG2 HG23 sing N N 185 THR OXT HXT sing N N 186 TRP N CA sing N N 187 TRP N H sing N N 188 TRP N H2 sing N N 189 TRP CA C sing N N 190 TRP CA CB sing N N 191 TRP CA HA sing N N 192 TRP C O doub N N 193 TRP C OXT sing N N 194 TRP CB CG sing N N 195 TRP CB HB2 sing N N 196 TRP CB HB3 sing N N 197 TRP CG CD1 doub Y N 198 TRP CG CD2 sing Y N 199 TRP CD1 NE1 sing Y N 200 TRP CD1 HD1 sing N N 201 TRP CD2 CE2 doub Y N 202 TRP CD2 CE3 sing Y N 203 TRP NE1 CE2 sing Y N 204 TRP NE1 HE1 sing N N 205 TRP CE2 CZ2 sing Y N 206 TRP CE3 CZ3 doub Y N 207 TRP CE3 HE3 sing N N 208 TRP CZ2 CH2 doub Y N 209 TRP CZ2 HZ2 sing N N 210 TRP CZ3 CH2 sing Y N 211 TRP CZ3 HZ3 sing N N 212 TRP CH2 HH2 sing N N 213 TRP OXT HXT sing N N 214 TYR N CA sing N N 215 TYR N H sing N N 216 TYR N H2 sing N N 217 TYR CA C sing N N 218 TYR CA CB sing N N 219 TYR CA HA sing N N 220 TYR C O doub N N 221 TYR C OXT sing N N 222 TYR CB CG sing N N 223 TYR CB HB2 sing N N 224 TYR CB HB3 sing N N 225 TYR CG CD1 doub Y N 226 TYR CG CD2 sing Y N 227 TYR CD1 CE1 sing Y N 228 TYR CD1 HD1 sing N N 229 TYR CD2 CE2 doub Y N 230 TYR CD2 HD2 sing N N 231 TYR CE1 CZ doub Y N 232 TYR CE1 HE1 sing N N 233 TYR CE2 CZ sing Y N 234 TYR CE2 HE2 sing N N 235 TYR CZ OH sing N N 236 TYR OH HH sing N N 237 TYR OXT HXT sing N N 238 VAL N CA sing N N 239 VAL N H sing N N 240 VAL N H2 sing N N 241 VAL CA C sing N N 242 VAL CA CB sing N N 243 VAL CA HA sing N N 244 VAL C O doub N N 245 VAL C OXT sing N N 246 VAL CB CG1 sing N N 247 VAL CB CG2 sing N N 248 VAL CB HB sing N N 249 VAL CG1 HG11 sing N N 250 VAL CG1 HG12 sing N N 251 VAL CG1 HG13 sing N N 252 VAL CG2 HG21 sing N N 253 VAL CG2 HG22 sing N N 254 VAL CG2 HG23 sing N N 255 VAL OXT HXT sing N N 256 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 2I1T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_