data_2I7M # _entry.id 2I7M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2I7M RCSB RCSB039238 WWPDB D_1000039238 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2007-09-25 _pdbx_database_PDB_obs_spr.pdb_id 2JV2 _pdbx_database_PDB_obs_spr.replace_pdb_id 2I7M _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 2I7M _pdbx_database_status.recvd_initial_deposition_date 2006-08-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Varnay, I.' 1 'Truffault, V.' 2 'Coles, M.' 3 # _citation.id primary _citation.title 'The solution structure of Ph1500-N' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Varnay, I.' 1 primary 'Djuranovic, S.' 2 primary 'Truffault, V.' 3 primary 'Lupas, A.' 4 primary 'Kessler, H.' 5 primary 'Coles, M.' 6 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein PH1500' _entity.formula_weight 9449.224 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHMEGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLV THP ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHMEGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLV THP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 MET n 1 8 GLU n 1 9 GLY n 1 10 VAL n 1 11 ILE n 1 12 MET n 1 13 SER n 1 14 GLU n 1 15 LEU n 1 16 LYS n 1 17 LEU n 1 18 LYS n 1 19 PRO n 1 20 LEU n 1 21 PRO n 1 22 LYS n 1 23 VAL n 1 24 GLU n 1 25 LEU n 1 26 PRO n 1 27 PRO n 1 28 ASP n 1 29 PHE n 1 30 VAL n 1 31 ASP n 1 32 VAL n 1 33 ILE n 1 34 ARG n 1 35 ILE n 1 36 LYS n 1 37 LEU n 1 38 GLN n 1 39 GLY n 1 40 LYS n 1 41 THR n 1 42 VAL n 1 43 ARG n 1 44 THR n 1 45 GLY n 1 46 ASP n 1 47 VAL n 1 48 ILE n 1 49 GLY n 1 50 ILE n 1 51 SER n 1 52 ILE n 1 53 LEU n 1 54 GLY n 1 55 LYS n 1 56 GLU n 1 57 VAL n 1 58 LYS n 1 59 PHE n 1 60 LYS n 1 61 VAL n 1 62 VAL n 1 63 GLN n 1 64 ALA n 1 65 TYR n 1 66 PRO n 1 67 SER n 1 68 PRO n 1 69 LEU n 1 70 ARG n 1 71 VAL n 1 72 GLU n 1 73 ASP n 1 74 ARG n 1 75 THR n 1 76 LYS n 1 77 ILE n 1 78 THR n 1 79 LEU n 1 80 VAL n 1 81 THR n 1 82 HIS n 1 83 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Ph1500 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O59169_PYRHO _struct_ref.pdbx_db_accession O59169 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MEGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHP _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2I7M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O59169 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 7 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2I7M HIS A 1 ? UNP O59169 ? ? 'EXPRESSION TAG' 1 1 1 2I7M HIS A 2 ? UNP O59169 ? ? 'EXPRESSION TAG' 2 2 1 2I7M HIS A 3 ? UNP O59169 ? ? 'EXPRESSION TAG' 3 3 1 2I7M HIS A 4 ? UNP O59169 ? ? 'EXPRESSION TAG' 4 4 1 2I7M HIS A 5 ? UNP O59169 ? ? 'EXPRESSION TAG' 5 5 1 2I7M HIS A 6 ? UNP O59169 ? ? 'EXPRESSION TAG' 6 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 3D_15N-separated_NOESY 2 3 1 HNHA 2 4 1 HNHB 2 5 1 CNH-NOESY 3 6 1 3D_13C-separated_NOESY 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units . # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM Ph1500-N, 50mM phosphate buffer, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1 mM Ph1500-N U-15N, 50mM phosphate buffer, 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 '1 mM Ph1500-N U-15N,13C, 50mM phosphate buffer, 90% H2O, 10% D2O' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 600 ? 2 DMX Bruker 900 ? # _pdbx_nmr_refine.entry_id 2I7M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Based on 752 distance restraints, talos restraints for 54 residues, 46 sidechain chi1 and 11 sidechain chi2 dihedral restraints, 43 Hbond restraints and 51 phi and 16 psi J-coupling restraints. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2I7M _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2I7M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XWINNMR 3.6 Bruker 1 'data analysis' SPARKY 3.110 'Goddard, T.D.' 2 'structure solution' X-PLOR NIH-2.9.4a 'Brunger, A' 3 refinement X-PLOR NIH-2.9.4a 'Brunger, A' 4 # _exptl.entry_id 2I7M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1254 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1254 _refine_hist.d_res_high . _refine_hist.d_res_low . _refine_hist.pdbx_refine_id . # _struct.entry_id 2I7M _struct.title 'Solution structure of the N-terminal domain of Ph1500' _struct.pdbx_descriptor 'Hypothetical protein PH1500' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2I7M _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'AAA ATPase Nc-domain-like, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 38 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 26 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 38 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 1 -3.92 2 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 1 -7.14 3 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 2 -3.08 4 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 2 -8.09 5 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 3 -5.93 6 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 3 -9.06 7 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 4 -4.02 8 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 4 -6.96 9 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 5 -3.73 10 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 5 -5.89 11 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 6 -3.87 12 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 6 -6.03 13 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 7 -5.04 14 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 7 -6.74 15 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 8 -4.26 16 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 8 -8.44 17 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 9 -4.45 18 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 9 -7.46 19 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 10 -6.08 20 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 10 -5.50 21 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 11 -4.18 22 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 11 -8.27 23 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 12 -4.69 24 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 12 -6.63 25 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 13 -5.61 26 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 13 -6.29 27 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 14 -5.74 28 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 14 -8.75 29 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 15 -5.61 30 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 15 -7.16 31 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 16 -4.11 32 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 16 -7.82 33 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 17 -5.07 34 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 17 -7.83 35 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 18 -4.08 36 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 18 -8.48 37 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 19 -5.28 38 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 19 -9.50 39 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 20 -4.09 40 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 20 -9.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 47 ? ILE A 52 ? VAL A 47 ILE A 52 A 2 LYS A 55 ? TYR A 65 ? LYS A 55 TYR A 65 A 3 GLU A 14 ? PRO A 19 ? GLU A 14 PRO A 19 A 4 LYS A 76 ? LEU A 79 ? LYS A 76 LEU A 79 B 1 THR A 41 ? VAL A 42 ? THR A 41 VAL A 42 B 2 LEU A 69 ? ARG A 70 ? LEU A 69 ARG A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 52 ? N ILE A 52 O LYS A 55 ? O LYS A 55 A 2 3 O TYR A 65 ? O TYR A 65 N GLU A 14 ? N GLU A 14 A 3 4 N LEU A 15 ? N LEU A 15 O LYS A 76 ? O LYS A 76 B 1 2 N VAL A 42 ? N VAL A 42 O LEU A 69 ? O LEU A 69 # _database_PDB_matrix.entry_id 2I7M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2I7M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 ? ? ? A . n A 1 2 HIS 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 MET 7 7 ? ? ? A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 PRO 83 83 83 PRO PRO A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-11 2 'Structure model' 1 1 2007-09-25 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 8 ? ? H A GLY 9 ? ? 1.06 2 1 OE1 A GLU 8 ? ? N A GLY 9 ? ? 1.68 3 6 O A ALA 64 ? ? HG A SER 67 ? ? 1.59 4 10 OG A SER 13 ? ? HG1 A THR 75 ? ? 1.51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 66 ? ? -73.67 -162.65 2 2 PRO A 66 ? ? -73.50 -162.96 3 3 PRO A 66 ? ? -74.94 -162.58 4 4 PRO A 66 ? ? -73.83 -162.61 5 5 PRO A 66 ? ? -75.18 -163.12 6 6 PRO A 66 ? ? -74.26 -163.40 7 7 LEU A 53 ? ? 49.75 27.30 8 7 PRO A 66 ? ? -74.17 -163.73 9 8 LEU A 53 ? ? 49.44 27.37 10 8 PRO A 66 ? ? -73.35 -163.48 11 9 LEU A 53 ? ? 49.66 27.25 12 9 PRO A 66 ? ? -73.60 -162.93 13 10 PRO A 66 ? ? -73.56 -163.89 14 11 VAL A 10 ? ? 53.73 171.35 15 11 LEU A 53 ? ? 49.59 27.24 16 11 PRO A 66 ? ? -73.57 -163.33 17 12 LEU A 53 ? ? 49.94 25.61 18 12 PRO A 66 ? ? -72.92 -162.69 19 13 LEU A 53 ? ? 49.95 27.20 20 13 PRO A 66 ? ? -74.04 -163.93 21 14 GLN A 38 ? ? -48.00 154.23 22 14 LEU A 53 ? ? 49.17 27.45 23 14 PRO A 66 ? ? -73.68 -162.78 24 15 VAL A 10 ? ? 53.73 171.35 25 15 LEU A 53 ? ? 49.71 27.88 26 15 PRO A 66 ? ? -75.11 -162.98 27 16 PRO A 66 ? ? -73.52 -162.95 28 17 LYS A 22 ? ? 49.14 78.99 29 17 LEU A 53 ? ? 49.76 27.81 30 17 PRO A 66 ? ? -74.31 -162.73 31 17 THR A 81 ? ? -142.16 18.63 32 18 LEU A 53 ? ? 49.98 27.48 33 18 PRO A 66 ? ? -73.28 -162.77 34 19 LYS A 22 ? ? 50.11 78.51 35 19 LEU A 53 ? ? 49.63 26.73 36 19 PRO A 66 ? ? -75.28 -162.39 37 20 LYS A 22 ? ? 49.15 77.71 38 20 PRO A 66 ? ? -75.31 -162.68 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 1 ? A HIS 1 2 1 Y 1 A HIS 2 ? A HIS 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A MET 7 ? A MET 7 8 2 Y 1 A HIS 1 ? A HIS 1 9 2 Y 1 A HIS 2 ? A HIS 2 10 2 Y 1 A HIS 3 ? A HIS 3 11 2 Y 1 A HIS 4 ? A HIS 4 12 2 Y 1 A HIS 5 ? A HIS 5 13 2 Y 1 A HIS 6 ? A HIS 6 14 2 Y 1 A MET 7 ? A MET 7 15 3 Y 1 A HIS 1 ? A HIS 1 16 3 Y 1 A HIS 2 ? A HIS 2 17 3 Y 1 A HIS 3 ? A HIS 3 18 3 Y 1 A HIS 4 ? A HIS 4 19 3 Y 1 A HIS 5 ? A HIS 5 20 3 Y 1 A HIS 6 ? A HIS 6 21 3 Y 1 A MET 7 ? A MET 7 22 4 Y 1 A HIS 1 ? A HIS 1 23 4 Y 1 A HIS 2 ? A HIS 2 24 4 Y 1 A HIS 3 ? A HIS 3 25 4 Y 1 A HIS 4 ? A HIS 4 26 4 Y 1 A HIS 5 ? A HIS 5 27 4 Y 1 A HIS 6 ? A HIS 6 28 4 Y 1 A MET 7 ? A MET 7 29 5 Y 1 A HIS 1 ? A HIS 1 30 5 Y 1 A HIS 2 ? A HIS 2 31 5 Y 1 A HIS 3 ? A HIS 3 32 5 Y 1 A HIS 4 ? A HIS 4 33 5 Y 1 A HIS 5 ? A HIS 5 34 5 Y 1 A HIS 6 ? A HIS 6 35 5 Y 1 A MET 7 ? A MET 7 36 6 Y 1 A HIS 1 ? A HIS 1 37 6 Y 1 A HIS 2 ? A HIS 2 38 6 Y 1 A HIS 3 ? A HIS 3 39 6 Y 1 A HIS 4 ? A HIS 4 40 6 Y 1 A HIS 5 ? A HIS 5 41 6 Y 1 A HIS 6 ? A HIS 6 42 6 Y 1 A MET 7 ? A MET 7 43 7 Y 1 A HIS 1 ? A HIS 1 44 7 Y 1 A HIS 2 ? A HIS 2 45 7 Y 1 A HIS 3 ? A HIS 3 46 7 Y 1 A HIS 4 ? A HIS 4 47 7 Y 1 A HIS 5 ? A HIS 5 48 7 Y 1 A HIS 6 ? A HIS 6 49 7 Y 1 A MET 7 ? A MET 7 50 8 Y 1 A HIS 1 ? A HIS 1 51 8 Y 1 A HIS 2 ? A HIS 2 52 8 Y 1 A HIS 3 ? A HIS 3 53 8 Y 1 A HIS 4 ? A HIS 4 54 8 Y 1 A HIS 5 ? A HIS 5 55 8 Y 1 A HIS 6 ? A HIS 6 56 8 Y 1 A MET 7 ? A MET 7 57 9 Y 1 A HIS 1 ? A HIS 1 58 9 Y 1 A HIS 2 ? A HIS 2 59 9 Y 1 A HIS 3 ? A HIS 3 60 9 Y 1 A HIS 4 ? A HIS 4 61 9 Y 1 A HIS 5 ? A HIS 5 62 9 Y 1 A HIS 6 ? A HIS 6 63 9 Y 1 A MET 7 ? A MET 7 64 10 Y 1 A HIS 1 ? A HIS 1 65 10 Y 1 A HIS 2 ? A HIS 2 66 10 Y 1 A HIS 3 ? A HIS 3 67 10 Y 1 A HIS 4 ? A HIS 4 68 10 Y 1 A HIS 5 ? A HIS 5 69 10 Y 1 A HIS 6 ? A HIS 6 70 10 Y 1 A MET 7 ? A MET 7 71 11 Y 1 A HIS 1 ? A HIS 1 72 11 Y 1 A HIS 2 ? A HIS 2 73 11 Y 1 A HIS 3 ? A HIS 3 74 11 Y 1 A HIS 4 ? A HIS 4 75 11 Y 1 A HIS 5 ? A HIS 5 76 11 Y 1 A HIS 6 ? A HIS 6 77 11 Y 1 A MET 7 ? A MET 7 78 12 Y 1 A HIS 1 ? A HIS 1 79 12 Y 1 A HIS 2 ? A HIS 2 80 12 Y 1 A HIS 3 ? A HIS 3 81 12 Y 1 A HIS 4 ? A HIS 4 82 12 Y 1 A HIS 5 ? A HIS 5 83 12 Y 1 A HIS 6 ? A HIS 6 84 12 Y 1 A MET 7 ? A MET 7 85 13 Y 1 A HIS 1 ? A HIS 1 86 13 Y 1 A HIS 2 ? A HIS 2 87 13 Y 1 A HIS 3 ? A HIS 3 88 13 Y 1 A HIS 4 ? A HIS 4 89 13 Y 1 A HIS 5 ? A HIS 5 90 13 Y 1 A HIS 6 ? A HIS 6 91 13 Y 1 A MET 7 ? A MET 7 92 14 Y 1 A HIS 1 ? A HIS 1 93 14 Y 1 A HIS 2 ? A HIS 2 94 14 Y 1 A HIS 3 ? A HIS 3 95 14 Y 1 A HIS 4 ? A HIS 4 96 14 Y 1 A HIS 5 ? A HIS 5 97 14 Y 1 A HIS 6 ? A HIS 6 98 14 Y 1 A MET 7 ? A MET 7 99 15 Y 1 A HIS 1 ? A HIS 1 100 15 Y 1 A HIS 2 ? A HIS 2 101 15 Y 1 A HIS 3 ? A HIS 3 102 15 Y 1 A HIS 4 ? A HIS 4 103 15 Y 1 A HIS 5 ? A HIS 5 104 15 Y 1 A HIS 6 ? A HIS 6 105 15 Y 1 A MET 7 ? A MET 7 106 16 Y 1 A HIS 1 ? A HIS 1 107 16 Y 1 A HIS 2 ? A HIS 2 108 16 Y 1 A HIS 3 ? A HIS 3 109 16 Y 1 A HIS 4 ? A HIS 4 110 16 Y 1 A HIS 5 ? A HIS 5 111 16 Y 1 A HIS 6 ? A HIS 6 112 16 Y 1 A MET 7 ? A MET 7 113 17 Y 1 A HIS 1 ? A HIS 1 114 17 Y 1 A HIS 2 ? A HIS 2 115 17 Y 1 A HIS 3 ? A HIS 3 116 17 Y 1 A HIS 4 ? A HIS 4 117 17 Y 1 A HIS 5 ? A HIS 5 118 17 Y 1 A HIS 6 ? A HIS 6 119 17 Y 1 A MET 7 ? A MET 7 120 18 Y 1 A HIS 1 ? A HIS 1 121 18 Y 1 A HIS 2 ? A HIS 2 122 18 Y 1 A HIS 3 ? A HIS 3 123 18 Y 1 A HIS 4 ? A HIS 4 124 18 Y 1 A HIS 5 ? A HIS 5 125 18 Y 1 A HIS 6 ? A HIS 6 126 18 Y 1 A MET 7 ? A MET 7 127 19 Y 1 A HIS 1 ? A HIS 1 128 19 Y 1 A HIS 2 ? A HIS 2 129 19 Y 1 A HIS 3 ? A HIS 3 130 19 Y 1 A HIS 4 ? A HIS 4 131 19 Y 1 A HIS 5 ? A HIS 5 132 19 Y 1 A HIS 6 ? A HIS 6 133 19 Y 1 A MET 7 ? A MET 7 134 20 Y 1 A HIS 1 ? A HIS 1 135 20 Y 1 A HIS 2 ? A HIS 2 136 20 Y 1 A HIS 3 ? A HIS 3 137 20 Y 1 A HIS 4 ? A HIS 4 138 20 Y 1 A HIS 5 ? A HIS 5 139 20 Y 1 A HIS 6 ? A HIS 6 140 20 Y 1 A MET 7 ? A MET 7 #