data_2I8F # _entry.id 2I8F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2I8F pdb_00002i8f 10.2210/pdb2i8f/pdb RCSB RCSB039267 ? ? WWPDB D_1000039267 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2007-06-05 ? 2 'Structure model' 1 1 2008-05-01 ? 3 'Structure model' 1 2 2011-07-13 ? 4 'Structure model' 1 3 2021-10-20 ? 5 'Structure model' 1 4 2024-11-20 ? 6 'Structure model' 2 0 2026-08-12 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 6 'Structure model' repository Remediation 'Metalloprotein remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Derived calculations' 10 6 'Structure model' 'Non-polymer description' 11 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_conn_type 9 4 'Structure model' struct_ref_seq_dif 10 4 'Structure model' struct_site 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' pdbx_entry_details 14 5 'Structure model' pdbx_modification_feature 15 6 'Structure model' chem_comp 16 6 'Structure model' chem_comp_atom 17 6 'Structure model' chem_comp_bond 18 6 'Structure model' entity 19 6 'Structure model' pdbx_modification_feature 20 6 'Structure model' pdbx_nonpoly_atom_coordination 21 6 'Structure model' pdbx_nonpoly_atom_coordination_sphere 22 6 'Structure model' pdbx_nonpoly_atom_coordination_sphere_order 23 6 'Structure model' pdbx_validate_chiral # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.conn_type_id' 17 4 'Structure model' '_struct_conn.id' 18 4 'Structure model' '_struct_conn.pdbx_dist_value' 19 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 32 4 'Structure model' '_struct_conn_type.id' 33 4 'Structure model' '_struct_ref_seq_dif.details' 34 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 35 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 36 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 37 6 'Structure model' '_chem_comp.formula' 38 6 'Structure model' '_chem_comp.formula_weight' 39 6 'Structure model' '_entity.formula_weight' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2I8F _pdbx_database_status.recvd_initial_deposition_date 2006-09-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1CCH _pdbx_database_related.details '1CCH is the Solution Conformation of Cytochrome c-551 from Pseudomonas stutzeri Zobell Determined by NMR' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liang, Q.' 1 'Timkovich, R.' 2 # _citation.id primary _citation.title 'Solution Conformation of the His-47 to Ala-47 Mutant of Pseudomonas stutzeri ZoBell Ferrocytochrome c-551.' _citation.journal_abbrev Biophys.J. _citation.journal_volume 93 _citation.page_first 1700 _citation.page_last 1706 _citation.year 2007 _citation.journal_id_ASTM BIOJAU _citation.country US _citation.journal_id_ISSN 0006-3495 _citation.journal_id_CSD 0030 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17496029 _citation.pdbx_database_id_DOI 10.1529/biophysj.106.102772 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liang, Q.' 1 ? primary 'Miller, G.T.' 2 ? primary 'Beeghley, C.A.' 3 ? primary 'Graf, C.B.' 4 ? primary 'Timkovich, R.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome c-551' 8505.787 1 ? H47A ? ? 2 non-polymer syn 'HEME C' 620.519 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytochrome c551, Cytochrome C8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALAIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLS LK ; _entity_poly.pdbx_seq_one_letter_code_can ;QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALAIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLS LK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ASP n 1 3 GLY n 1 4 GLU n 1 5 ALA n 1 6 LEU n 1 7 PHE n 1 8 LYS n 1 9 SER n 1 10 LYS n 1 11 PRO n 1 12 CYS n 1 13 ALA n 1 14 ALA n 1 15 CYS n 1 16 HIS n 1 17 SER n 1 18 VAL n 1 19 ASP n 1 20 THR n 1 21 LYS n 1 22 MET n 1 23 VAL n 1 24 GLY n 1 25 PRO n 1 26 ALA n 1 27 LEU n 1 28 LYS n 1 29 GLU n 1 30 VAL n 1 31 ALA n 1 32 ALA n 1 33 LYS n 1 34 ASN n 1 35 ALA n 1 36 GLY n 1 37 VAL n 1 38 GLU n 1 39 GLY n 1 40 ALA n 1 41 ALA n 1 42 ASP n 1 43 THR n 1 44 LEU n 1 45 ALA n 1 46 LEU n 1 47 ALA n 1 48 ILE n 1 49 LYS n 1 50 ASN n 1 51 GLY n 1 52 SER n 1 53 GLN n 1 54 GLY n 1 55 VAL n 1 56 TRP n 1 57 GLY n 1 58 PRO n 1 59 ILE n 1 60 PRO n 1 61 MET n 1 62 PRO n 1 63 PRO n 1 64 ASN n 1 65 PRO n 1 66 VAL n 1 67 THR n 1 68 GLU n 1 69 GLU n 1 70 GLU n 1 71 ALA n 1 72 LYS n 1 73 ILE n 1 74 LEU n 1 75 ALA n 1 76 GLU n 1 77 TRP n 1 78 VAL n 1 79 LEU n 1 80 SER n 1 81 LEU n 1 82 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene nirM _entity_src_gen.gene_src_species 'Pseudomonas stutzeri' _entity_src_gen.gene_src_strain ZoBell _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas stutzeri ZoBell' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 96564 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain UT5600 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBR329 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H36 Fe N4 O4' 620.519 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LYS 82 82 82 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 83 _pdbx_nonpoly_scheme.auth_seq_num 83 _pdbx_nonpoly_scheme.pdb_mon_id HEC _pdbx_nonpoly_scheme.auth_mon_id HEC _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 2I8F _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2I8F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2I8F _struct.title 'Solution Conformation of the H47A Mutant of Pseudomonas stutzeri ZoBell Ferrocytochrome c-551' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2I8F _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'helix-turn-helix, cytochrome, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CY551_PSEST _struct_ref.pdbx_db_accession P00101 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLS LK ; _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2I8F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00101 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2I8F _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 47 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00101 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 69 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 47 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? LYS A 10 ? ASP A 2 LYS A 10 1 ? 9 HELX_P HELX_P2 2 ALA A 26 ? ASN A 34 ? ALA A 26 ASN A 34 1 ? 9 HELX_P HELX_P3 3 GLY A 39 ? ASN A 50 ? GLY A 39 ASN A 50 1 ? 12 HELX_P HELX_P4 4 THR A 67 ? SER A 80 ? THR A 67 SER A 80 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 12 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 12 A HEC 83 1_555 ? ? ? ? ? ? ? 1.832 ? ? covale2 covale none ? A CYS 15 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 15 A HEC 83 1_555 ? ? ? ? ? ? ? 1.841 ? ? metalc1 metalc ? ? A HIS 16 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 16 A HEC 83 1_555 ? ? ? ? ? ? ? 1.959 ? ? metalc2 metalc ? ? A MET 61 SD ? ? ? 1_555 B HEC . FE ? ? A MET 61 A HEC 83 1_555 ? ? ? ? ? ? ? 2.378 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 16 ? A HIS 16 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 NA ? B HEC . ? A HEC 83 ? 1_555 89.8 ? 2 NE2 ? A HIS 16 ? A HIS 16 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 NB ? B HEC . ? A HEC 83 ? 1_555 90.2 ? 3 NA ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 NB ? B HEC . ? A HEC 83 ? 1_555 90.2 ? 4 NE2 ? A HIS 16 ? A HIS 16 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 NC ? B HEC . ? A HEC 83 ? 1_555 90.4 ? 5 NA ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 NC ? B HEC . ? A HEC 83 ? 1_555 179.8 ? 6 NB ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 NC ? B HEC . ? A HEC 83 ? 1_555 89.8 ? 7 NE2 ? A HIS 16 ? A HIS 16 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 ND ? B HEC . ? A HEC 83 ? 1_555 89.5 ? 8 NA ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 ND ? B HEC . ? A HEC 83 ? 1_555 90.1 ? 9 NB ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 ND ? B HEC . ? A HEC 83 ? 1_555 179.5 ? 10 NC ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 ND ? B HEC . ? A HEC 83 ? 1_555 89.9 ? 11 NE2 ? A HIS 16 ? A HIS 16 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 SD ? A MET 61 ? A MET 61 ? 1_555 177.9 ? 12 NA ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 SD ? A MET 61 ? A MET 61 ? 1_555 88.2 ? 13 NB ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 SD ? A MET 61 ? A MET 61 ? 1_555 90.4 ? 14 NC ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 SD ? A MET 61 ? A MET 61 ? 1_555 91.7 ? 15 ND ? B HEC . ? A HEC 83 ? 1_555 FE ? B HEC . ? A HEC 83 ? 1_555 SD ? A MET 61 ? A MET 61 ? 1_555 90.0 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 HEC B . ? CYS A 12 ? HEC A 83 ? 1_555 CYS A 12 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 2 HEC B . ? CYS A 15 ? HEC A 83 ? 1_555 CYS A 15 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like 3 HEC B . ? HIS A 16 ? HEC A 83 ? 1_555 HIS A 16 ? 1_555 FE NE2 HIS 19 HEC None 'Metal coordination' 4 HEC B . ? MET A 61 ? HEC A 83 ? 1_555 MET A 61 ? 1_555 FE SD MET 22 HEC None 'Metal coordination' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEC _struct_site.pdbx_auth_seq_id 83 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'BINDING SITE FOR RESIDUE HEC A 83' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 PRO A 11 ? PRO A 11 . ? 1_555 ? 2 AC1 16 CYS A 12 ? CYS A 12 . ? 1_555 ? 3 AC1 16 CYS A 15 ? CYS A 15 . ? 1_555 ? 4 AC1 16 HIS A 16 ? HIS A 16 . ? 1_555 ? 5 AC1 16 PRO A 25 ? PRO A 25 . ? 1_555 ? 6 AC1 16 LEU A 44 ? LEU A 44 . ? 1_555 ? 7 AC1 16 ALA A 47 ? ALA A 47 . ? 1_555 ? 8 AC1 16 ILE A 48 ? ILE A 48 . ? 1_555 ? 9 AC1 16 SER A 52 ? SER A 52 . ? 1_555 ? 10 AC1 16 GLY A 54 ? GLY A 54 . ? 1_555 ? 11 AC1 16 VAL A 55 ? VAL A 55 . ? 1_555 ? 12 AC1 16 TRP A 56 ? TRP A 56 . ? 1_555 ? 13 AC1 16 GLY A 57 ? GLY A 57 . ? 1_555 ? 14 AC1 16 ILE A 59 ? ILE A 59 . ? 1_555 ? 15 AC1 16 MET A 61 ? MET A 61 . ? 1_555 ? 16 AC1 16 LEU A 74 ? LEU A 74 . ? 1_555 ? # _pdbx_entry_details.entry_id 2I8F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 19 ? ? -124.41 -61.91 2 1 MET A 22 ? ? -99.41 -64.47 3 1 ALA A 35 ? ? -101.97 74.26 4 1 VAL A 55 ? ? -144.77 -42.62 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id NA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id HEC _pdbx_validate_chiral.auth_seq_id 83 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _pdbx_nonpoly_atom_coordination.geometry_id _pdbx_nonpoly_atom_coordination.label_asym_id _pdbx_nonpoly_atom_coordination.label_seq_id _pdbx_nonpoly_atom_coordination.label_comp_id _pdbx_nonpoly_atom_coordination.label_atom_id _pdbx_nonpoly_atom_coordination.label_alt_id _pdbx_nonpoly_atom_coordination.auth_asym_id _pdbx_nonpoly_atom_coordination.auth_seq_id _pdbx_nonpoly_atom_coordination.auth_comp_id _pdbx_nonpoly_atom_coordination.auth_atom_id _pdbx_nonpoly_atom_coordination.PDB_ins_code _pdbx_nonpoly_atom_coordination.number _pdbx_nonpoly_atom_coordination.geometry_calculated _pdbx_nonpoly_atom_coordination.remark _pdbx_nonpoly_atom_coordination.geometry_generic _pdbx_nonpoly_atom_coordination.geometry_abbr _pdbx_nonpoly_atom_coordination.provenance _pdbx_nonpoly_atom_coordination.assessment 1 B . HEC FE ? A 83 HEC FE ? 6 octahedron regular octahedral OCT FindGeo Expected 1 B . HEC FE ? A 83 HEC FE ? 6 octahedral regular octahedral OCT MetalCoord Expected # _pdbx_nonpoly_atom_coordination_sphere.id 1 _pdbx_nonpoly_atom_coordination_sphere.geometry_id 1 _pdbx_nonpoly_atom_coordination_sphere.label_asym_id B _pdbx_nonpoly_atom_coordination_sphere.label_seq_id . _pdbx_nonpoly_atom_coordination_sphere.label_comp_id HEC _pdbx_nonpoly_atom_coordination_sphere.label_atom_id FE _pdbx_nonpoly_atom_coordination_sphere.label_alt_id ? _pdbx_nonpoly_atom_coordination_sphere.auth_asym_id A _pdbx_nonpoly_atom_coordination_sphere.auth_seq_id 83 _pdbx_nonpoly_atom_coordination_sphere.auth_comp_id HEC _pdbx_nonpoly_atom_coordination_sphere.auth_atom_id FE _pdbx_nonpoly_atom_coordination_sphere.PDB_ins_code ? _pdbx_nonpoly_atom_coordination_sphere.descriptor '@OCT{Fe,N,N,N,N,N,S}' _pdbx_nonpoly_atom_coordination_sphere.provenance MetalCoord # loop_ _pdbx_nonpoly_atom_coordination_sphere_order.sphere_id _pdbx_nonpoly_atom_coordination_sphere_order.label_asym_id _pdbx_nonpoly_atom_coordination_sphere_order.label_seq_id _pdbx_nonpoly_atom_coordination_sphere_order.label_comp_id _pdbx_nonpoly_atom_coordination_sphere_order.label_atom_id _pdbx_nonpoly_atom_coordination_sphere_order.label_alt_id _pdbx_nonpoly_atom_coordination_sphere_order.auth_asym_id _pdbx_nonpoly_atom_coordination_sphere_order.auth_seq_id _pdbx_nonpoly_atom_coordination_sphere_order.auth_comp_id _pdbx_nonpoly_atom_coordination_sphere_order.auth_atom_id _pdbx_nonpoly_atom_coordination_sphere_order.PDB_ins_code _pdbx_nonpoly_atom_coordination_sphere_order.symmetry_operation _pdbx_nonpoly_atom_coordination_sphere_order.atom_place 1 B . HEC NA ? A 83 HEC NA ? x,y,z 1 1 B . HEC NB ? A 83 HEC NB ? x,y,z 2 1 B . HEC NC ? A 83 HEC NC ? x,y,z 3 1 B . HEC ND ? A 83 HEC ND ? x,y,z 4 1 A 16 HIS NE2 ? A 16 HIS NE2 ? x,y,z 5 1 A 61 MET SD ? A 61 MET SD ? x,y,z 6 # _pdbx_nmr_ensemble.entry_id 2I8F _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 2I8F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5 mM H47A c-551, 50 mM sodium phosphate buffer, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D TOCSY' 1 2 1 '2D NOESY' 1 3 1 DQF-COSY 1 # _pdbx_nmr_refine.entry_id 2I8F _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 1511 restraints, 1414 are NOE-derived distance constraints, 67 dihedral angle restraints, 30 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement ARIA '2.0 alpha' ;M.NILGES, S. I. O'DONOGHUE ; 1 refinement CNS 1.1 ;A. Brunger, P. D. Adams, G. M. Clore, W. L. Delano, P. Gros, R. W. Gross-Kunstleve, J. S. Jiang, J. Kuszewski, M. Nilges, N. S. Pannu, R. J. Read, L. M. Rice, T. Simonson, G. L. Warren ; 2 processing NMRPipe 'July, 2004' 'F. Delaglio, S. Grzesiek, G.W. Vuister, G. Zhu, J. Pfeifer, A. Bax' 3 collection TopSpin 1.3 Bruker 4 'data analysis' NMRView 6.2.10 'B. A. Johnson, R. A. Belvins' 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HEC FE FE N N 110 HEC CHA C N N 111 HEC CHB C N N 112 HEC CHC C N N 113 HEC CHD C N N 114 HEC NA N N R 115 HEC C1A C N N 116 HEC C2A C N N 117 HEC C3A C N N 118 HEC C4A C N N 119 HEC CMA C N N 120 HEC CAA C N N 121 HEC CBA C N N 122 HEC CGA C N N 123 HEC O1A O N N 124 HEC O2A O N N 125 HEC NB N N N 126 HEC C1B C N N 127 HEC C2B C N N 128 HEC C3B C N N 129 HEC C4B C N N 130 HEC CMB C N N 131 HEC CAB C N N 132 HEC CBB C N N 133 HEC NC N Y N 134 HEC C1C C Y N 135 HEC C2C C Y N 136 HEC C3C C Y N 137 HEC C4C C Y N 138 HEC CMC C N N 139 HEC CAC C N N 140 HEC CBC C N N 141 HEC ND N N N 142 HEC C1D C N N 143 HEC C2D C N N 144 HEC C3D C N N 145 HEC C4D C N N 146 HEC CMD C N N 147 HEC CAD C N N 148 HEC CBD C N N 149 HEC CGD C N N 150 HEC O1D O N N 151 HEC O2D O N N 152 HEC HHA H N N 153 HEC HHB H N N 154 HEC HHC H N N 155 HEC HHD H N N 156 HEC HMA1 H N N 157 HEC HMA2 H N N 158 HEC HMA3 H N N 159 HEC HAA1 H N N 160 HEC HAA2 H N N 161 HEC HBA1 H N N 162 HEC HBA2 H N N 163 HEC H2A H N N 164 HEC HMB1 H N N 165 HEC HMB2 H N N 166 HEC HMB3 H N N 167 HEC HAB H N N 168 HEC HBB1 H N N 169 HEC HBB2 H N N 170 HEC HBB3 H N N 171 HEC HMC1 H N N 172 HEC HMC2 H N N 173 HEC HMC3 H N N 174 HEC HAC H N N 175 HEC HBC1 H N N 176 HEC HBC2 H N N 177 HEC HBC3 H N N 178 HEC HMD1 H N N 179 HEC HMD2 H N N 180 HEC HMD3 H N N 181 HEC HAD1 H N N 182 HEC HAD2 H N N 183 HEC HBD1 H N N 184 HEC HBD2 H N N 185 HEC H2D H N N 186 HEC H1 H N N 187 HEC H2 H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 VAL N N N N 397 VAL CA C N S 398 VAL C C N N 399 VAL O O N N 400 VAL CB C N N 401 VAL CG1 C N N 402 VAL CG2 C N N 403 VAL OXT O N N 404 VAL H H N N 405 VAL H2 H N N 406 VAL HA H N N 407 VAL HB H N N 408 VAL HG11 H N N 409 VAL HG12 H N N 410 VAL HG13 H N N 411 VAL HG21 H N N 412 VAL HG22 H N N 413 VAL HG23 H N N 414 VAL HXT H N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HEC FE NA sing N N 103 HEC FE NB sing N N 104 HEC FE NC sing N N 105 HEC FE ND sing N N 106 HEC CHA C1A doub N N 107 HEC CHA C4D sing N N 108 HEC CHA HHA sing N N 109 HEC CHB C4A doub N N 110 HEC CHB C1B sing N N 111 HEC CHB HHB sing N N 112 HEC CHC C4B doub N N 113 HEC CHC C1C sing N N 114 HEC CHC HHC sing N N 115 HEC CHD C4C sing N N 116 HEC CHD C1D doub N N 117 HEC CHD HHD sing N N 118 HEC NA C1A sing N N 119 HEC NA C4A sing N N 120 HEC C1A C2A sing N N 121 HEC C2A C3A doub N N 122 HEC C2A CAA sing N N 123 HEC C3A C4A sing N N 124 HEC C3A CMA sing N N 125 HEC CMA HMA1 sing N N 126 HEC CMA HMA2 sing N N 127 HEC CMA HMA3 sing N N 128 HEC CAA CBA sing N N 129 HEC CAA HAA1 sing N N 130 HEC CAA HAA2 sing N N 131 HEC CBA CGA sing N N 132 HEC CBA HBA1 sing N N 133 HEC CBA HBA2 sing N N 134 HEC CGA O1A doub N N 135 HEC CGA O2A sing N N 136 HEC O2A H2A sing N N 137 HEC NB C1B doub N N 138 HEC NB C4B sing N N 139 HEC C1B C2B sing N N 140 HEC C2B C3B doub N N 141 HEC C2B CMB sing N N 142 HEC C3B C4B sing N N 143 HEC C3B CAB sing N N 144 HEC CMB HMB1 sing N N 145 HEC CMB HMB2 sing N N 146 HEC CMB HMB3 sing N N 147 HEC CAB CBB sing N N 148 HEC CAB HAB sing N N 149 HEC CBB HBB1 sing N N 150 HEC CBB HBB2 sing N N 151 HEC CBB HBB3 sing N N 152 HEC NC C1C sing Y N 153 HEC NC C4C sing Y N 154 HEC C1C C2C doub Y N 155 HEC C2C C3C sing Y N 156 HEC C2C CMC sing N N 157 HEC C3C C4C doub Y N 158 HEC C3C CAC sing N N 159 HEC CMC HMC1 sing N N 160 HEC CMC HMC2 sing N N 161 HEC CMC HMC3 sing N N 162 HEC CAC CBC sing N N 163 HEC CAC HAC sing N N 164 HEC CBC HBC1 sing N N 165 HEC CBC HBC2 sing N N 166 HEC CBC HBC3 sing N N 167 HEC ND C1D sing N N 168 HEC ND C4D doub N N 169 HEC C1D C2D sing N N 170 HEC C2D C3D doub N N 171 HEC C2D CMD sing N N 172 HEC C3D C4D sing N N 173 HEC C3D CAD sing N N 174 HEC CMD HMD1 sing N N 175 HEC CMD HMD2 sing N N 176 HEC CMD HMD3 sing N N 177 HEC CAD CBD sing N N 178 HEC CAD HAD1 sing N N 179 HEC CAD HAD2 sing N N 180 HEC CBD CGD sing N N 181 HEC CBD HBD1 sing N N 182 HEC CBD HBD2 sing N N 183 HEC CGD O1D doub N N 184 HEC CGD O2D sing N N 185 HEC O2D H2D sing N N 186 HEC H1 CAB sing N N 187 HEC H2 CAC sing N N 188 HIS N CA sing N N 189 HIS N H sing N N 190 HIS N H2 sing N N 191 HIS CA C sing N N 192 HIS CA CB sing N N 193 HIS CA HA sing N N 194 HIS C O doub N N 195 HIS C OXT sing N N 196 HIS CB CG sing N N 197 HIS CB HB2 sing N N 198 HIS CB HB3 sing N N 199 HIS CG ND1 sing Y N 200 HIS CG CD2 doub Y N 201 HIS ND1 CE1 doub Y N 202 HIS ND1 HD1 sing N N 203 HIS CD2 NE2 sing Y N 204 HIS CD2 HD2 sing N N 205 HIS CE1 NE2 sing Y N 206 HIS CE1 HE1 sing N N 207 HIS NE2 HE2 sing N N 208 HIS OXT HXT sing N N 209 ILE N CA sing N N 210 ILE N H sing N N 211 ILE N H2 sing N N 212 ILE CA C sing N N 213 ILE CA CB sing N N 214 ILE CA HA sing N N 215 ILE C O doub N N 216 ILE C OXT sing N N 217 ILE CB CG1 sing N N 218 ILE CB CG2 sing N N 219 ILE CB HB sing N N 220 ILE CG1 CD1 sing N N 221 ILE CG1 HG12 sing N N 222 ILE CG1 HG13 sing N N 223 ILE CG2 HG21 sing N N 224 ILE CG2 HG22 sing N N 225 ILE CG2 HG23 sing N N 226 ILE CD1 HD11 sing N N 227 ILE CD1 HD12 sing N N 228 ILE CD1 HD13 sing N N 229 ILE OXT HXT sing N N 230 LEU N CA sing N N 231 LEU N H sing N N 232 LEU N H2 sing N N 233 LEU CA C sing N N 234 LEU CA CB sing N N 235 LEU CA HA sing N N 236 LEU C O doub N N 237 LEU C OXT sing N N 238 LEU CB CG sing N N 239 LEU CB HB2 sing N N 240 LEU CB HB3 sing N N 241 LEU CG CD1 sing N N 242 LEU CG CD2 sing N N 243 LEU CG HG sing N N 244 LEU CD1 HD11 sing N N 245 LEU CD1 HD12 sing N N 246 LEU CD1 HD13 sing N N 247 LEU CD2 HD21 sing N N 248 LEU CD2 HD22 sing N N 249 LEU CD2 HD23 sing N N 250 LEU OXT HXT sing N N 251 LYS N CA sing N N 252 LYS N H sing N N 253 LYS N H2 sing N N 254 LYS CA C sing N N 255 LYS CA CB sing N N 256 LYS CA HA sing N N 257 LYS C O doub N N 258 LYS C OXT sing N N 259 LYS CB CG sing N N 260 LYS CB HB2 sing N N 261 LYS CB HB3 sing N N 262 LYS CG CD sing N N 263 LYS CG HG2 sing N N 264 LYS CG HG3 sing N N 265 LYS CD CE sing N N 266 LYS CD HD2 sing N N 267 LYS CD HD3 sing N N 268 LYS CE NZ sing N N 269 LYS CE HE2 sing N N 270 LYS CE HE3 sing N N 271 LYS NZ HZ1 sing N N 272 LYS NZ HZ2 sing N N 273 LYS NZ HZ3 sing N N 274 LYS OXT HXT sing N N 275 MET N CA sing N N 276 MET N H sing N N 277 MET N H2 sing N N 278 MET CA C sing N N 279 MET CA CB sing N N 280 MET CA HA sing N N 281 MET C O doub N N 282 MET C OXT sing N N 283 MET CB CG sing N N 284 MET CB HB2 sing N N 285 MET CB HB3 sing N N 286 MET CG SD sing N N 287 MET CG HG2 sing N N 288 MET CG HG3 sing N N 289 MET SD CE sing N N 290 MET CE HE1 sing N N 291 MET CE HE2 sing N N 292 MET CE HE3 sing N N 293 MET OXT HXT sing N N 294 PHE N CA sing N N 295 PHE N H sing N N 296 PHE N H2 sing N N 297 PHE CA C sing N N 298 PHE CA CB sing N N 299 PHE CA HA sing N N 300 PHE C O doub N N 301 PHE C OXT sing N N 302 PHE CB CG sing N N 303 PHE CB HB2 sing N N 304 PHE CB HB3 sing N N 305 PHE CG CD1 doub Y N 306 PHE CG CD2 sing Y N 307 PHE CD1 CE1 sing Y N 308 PHE CD1 HD1 sing N N 309 PHE CD2 CE2 doub Y N 310 PHE CD2 HD2 sing N N 311 PHE CE1 CZ doub Y N 312 PHE CE1 HE1 sing N N 313 PHE CE2 CZ sing Y N 314 PHE CE2 HE2 sing N N 315 PHE CZ HZ sing N N 316 PHE OXT HXT sing N N 317 PRO N CA sing N N 318 PRO N CD sing N N 319 PRO N H sing N N 320 PRO CA C sing N N 321 PRO CA CB sing N N 322 PRO CA HA sing N N 323 PRO C O doub N N 324 PRO C OXT sing N N 325 PRO CB CG sing N N 326 PRO CB HB2 sing N N 327 PRO CB HB3 sing N N 328 PRO CG CD sing N N 329 PRO CG HG2 sing N N 330 PRO CG HG3 sing N N 331 PRO CD HD2 sing N N 332 PRO CD HD3 sing N N 333 PRO OXT HXT sing N N 334 SER N CA sing N N 335 SER N H sing N N 336 SER N H2 sing N N 337 SER CA C sing N N 338 SER CA CB sing N N 339 SER CA HA sing N N 340 SER C O doub N N 341 SER C OXT sing N N 342 SER CB OG sing N N 343 SER CB HB2 sing N N 344 SER CB HB3 sing N N 345 SER OG HG sing N N 346 SER OXT HXT sing N N 347 THR N CA sing N N 348 THR N H sing N N 349 THR N H2 sing N N 350 THR CA C sing N N 351 THR CA CB sing N N 352 THR CA HA sing N N 353 THR C O doub N N 354 THR C OXT sing N N 355 THR CB OG1 sing N N 356 THR CB CG2 sing N N 357 THR CB HB sing N N 358 THR OG1 HG1 sing N N 359 THR CG2 HG21 sing N N 360 THR CG2 HG22 sing N N 361 THR CG2 HG23 sing N N 362 THR OXT HXT sing N N 363 TRP N CA sing N N 364 TRP N H sing N N 365 TRP N H2 sing N N 366 TRP CA C sing N N 367 TRP CA CB sing N N 368 TRP CA HA sing N N 369 TRP C O doub N N 370 TRP C OXT sing N N 371 TRP CB CG sing N N 372 TRP CB HB2 sing N N 373 TRP CB HB3 sing N N 374 TRP CG CD1 doub Y N 375 TRP CG CD2 sing Y N 376 TRP CD1 NE1 sing Y N 377 TRP CD1 HD1 sing N N 378 TRP CD2 CE2 doub Y N 379 TRP CD2 CE3 sing Y N 380 TRP NE1 CE2 sing Y N 381 TRP NE1 HE1 sing N N 382 TRP CE2 CZ2 sing Y N 383 TRP CE3 CZ3 doub Y N 384 TRP CE3 HE3 sing N N 385 TRP CZ2 CH2 doub Y N 386 TRP CZ2 HZ2 sing N N 387 TRP CZ3 CH2 sing Y N 388 TRP CZ3 HZ3 sing N N 389 TRP CH2 HH2 sing N N 390 TRP OXT HXT sing N N 391 VAL N CA sing N N 392 VAL N H sing N N 393 VAL N H2 sing N N 394 VAL CA C sing N N 395 VAL CA CB sing N N 396 VAL CA HA sing N N 397 VAL C O doub N N 398 VAL C OXT sing N N 399 VAL CB CG1 sing N N 400 VAL CB CG2 sing N N 401 VAL CB HB sing N N 402 VAL CG1 HG11 sing N N 403 VAL CG1 HG12 sing N N 404 VAL CG1 HG13 sing N N 405 VAL CG2 HG21 sing N N 406 VAL CG2 HG22 sing N N 407 VAL CG2 HG23 sing N N 408 VAL OXT HXT sing N N 409 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2I8F _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ #