data_2I9C # _entry.id 2I9C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.357 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2I9C pdb_00002i9c 10.2210/pdb2i9c/pdb RCSB RCSB039300 ? ? WWPDB D_1000039300 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC6185 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2I9C _pdbx_database_status.recvd_initial_deposition_date 2006-09-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cymborowski, M.T.' 1 ? 'Evdokimova, E.' 2 ? 'Kagan, O.' 3 ? 'Chruszcz, M.' 4 ? 'Savchenko, A.' 5 ? 'Edwards, A.' 6 ? 'Joachimiak, A.' 7 ? 'Minor, W.' 8 0000-0001-7075-7090 'Midwest Center for Structural Genomics (MCSG)' 9 ? # _citation.id primary _citation.title 'Crystal Structure of the Protein RPA1889 from Rhodopseudomonas palustris CGA009' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cymborowski, M.T.' 1 ? primary 'Evdokimova, E.' 2 ? primary 'Kagan, O.' 3 ? primary 'Chruszcz, M.' 4 ? primary 'Savchenko, A.' 5 ? primary 'Edwards, A.' 6 ? primary 'Minor, W.' 7 0000-0001-7075-7090 # _cell.entry_id 2I9C _cell.length_a 78.022 _cell.length_b 78.022 _cell.length_c 38.979 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2I9C _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein RPA1889' 13903.209 1 ? ? ? ? 2 non-polymer syn 'ACETATE ION' 59.044 2 ? ? ? ? 3 water nat water 18.015 92 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SKLDLHQ(MSE)TTQDLVALFAKVTVEQDDALLGNQISRFNRLFGV(MSE)AEIADELKARDGDQRTALLSLFEY PN(MSE)QVRLQAAKLTLAVAPVKAREQLEAIVSSKWFPQAGDAG(MSE)CLDLLDDGTFKPK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKLDLHQMTTQDLVALFAKVTVEQDDALLGNQISRFNRLFGVMAEIADELKARDGDQRTALLSLFEYPNMQVRLQAAKL TLAVAPVKAREQLEAIVSSKWFPQAGDAGMCLDLLDDGTFKPK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC6185 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 LYS n 1 4 LEU n 1 5 ASP n 1 6 LEU n 1 7 HIS n 1 8 GLN n 1 9 MSE n 1 10 THR n 1 11 THR n 1 12 GLN n 1 13 ASP n 1 14 LEU n 1 15 VAL n 1 16 ALA n 1 17 LEU n 1 18 PHE n 1 19 ALA n 1 20 LYS n 1 21 VAL n 1 22 THR n 1 23 VAL n 1 24 GLU n 1 25 GLN n 1 26 ASP n 1 27 ASP n 1 28 ALA n 1 29 LEU n 1 30 LEU n 1 31 GLY n 1 32 ASN n 1 33 GLN n 1 34 ILE n 1 35 SER n 1 36 ARG n 1 37 PHE n 1 38 ASN n 1 39 ARG n 1 40 LEU n 1 41 PHE n 1 42 GLY n 1 43 VAL n 1 44 MSE n 1 45 ALA n 1 46 GLU n 1 47 ILE n 1 48 ALA n 1 49 ASP n 1 50 GLU n 1 51 LEU n 1 52 LYS n 1 53 ALA n 1 54 ARG n 1 55 ASP n 1 56 GLY n 1 57 ASP n 1 58 GLN n 1 59 ARG n 1 60 THR n 1 61 ALA n 1 62 LEU n 1 63 LEU n 1 64 SER n 1 65 LEU n 1 66 PHE n 1 67 GLU n 1 68 TYR n 1 69 PRO n 1 70 ASN n 1 71 MSE n 1 72 GLN n 1 73 VAL n 1 74 ARG n 1 75 LEU n 1 76 GLN n 1 77 ALA n 1 78 ALA n 1 79 LYS n 1 80 LEU n 1 81 THR n 1 82 LEU n 1 83 ALA n 1 84 VAL n 1 85 ALA n 1 86 PRO n 1 87 VAL n 1 88 LYS n 1 89 ALA n 1 90 ARG n 1 91 GLU n 1 92 GLN n 1 93 LEU n 1 94 GLU n 1 95 ALA n 1 96 ILE n 1 97 VAL n 1 98 SER n 1 99 SER n 1 100 LYS n 1 101 TRP n 1 102 PHE n 1 103 PRO n 1 104 GLN n 1 105 ALA n 1 106 GLY n 1 107 ASP n 1 108 ALA n 1 109 GLY n 1 110 MSE n 1 111 CYS n 1 112 LEU n 1 113 ASP n 1 114 LEU n 1 115 LEU n 1 116 ASP n 1 117 ASP n 1 118 GLY n 1 119 THR n 1 120 PHE n 1 121 LYS n 1 122 PRO n 1 123 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Rhodopseudomonas _entity_src_gen.pdbx_gene_src_gene RPA1889 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhodopseudomonas palustris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1076 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 GOLD (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6N8L4_RHOPA _struct_ref.pdbx_db_accession Q6N8L4 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2I9C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6N8L4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2I9C MSE A 1 ? UNP Q6N8L4 MET 1 'modified residue' 1 1 1 2I9C MSE A 9 ? UNP Q6N8L4 MET 9 'modified residue' 9 2 1 2I9C MSE A 44 ? UNP Q6N8L4 MET 44 'modified residue' 44 3 1 2I9C MSE A 71 ? UNP Q6N8L4 MET 71 'modified residue' 71 4 1 2I9C MSE A 110 ? UNP Q6N8L4 MET 110 'modified residue' 110 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2I9C _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_percent_sol 50.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '5% Tascimate, 10% PEG5000 MME, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-3 _diffrn_detector.pdbx_collection_date 2006-06-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97904 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97904 # _reflns.entry_id 2I9C _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I -3.0 _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 67.57 _reflns.number_all 9484 _reflns.number_obs 9449 _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rsym_value 0.057 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 30.3 _reflns.pdbx_redundancy 7.000 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.02 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.299 _reflns_shell.pdbx_Rsym_value 0.298 _reflns_shell.meanI_over_sigI_obs 6.83 _reflns_shell.pdbx_redundancy 7.1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 206 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2I9C _refine.ls_number_reflns_obs 8989 _refine.ls_number_reflns_all 9449 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.79 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 99.73 _refine.ls_R_factor_obs 0.17603 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17472 _refine.ls_R_factor_R_free 0.20189 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 451 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.960 _refine.B_iso_mean 33.113 _refine.aniso_B[1][1] 0.86 _refine.aniso_B[2][2] 0.86 _refine.aniso_B[3][3] -1.29 _refine.aniso_B[1][2] 0.43 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'COOT HAS ALSO BEEN A SOFTWARE USED IN THE REFINEMENT. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.168 _refine.pdbx_overall_ESU_R_Free 0.141 _refine.overall_SU_ML 0.100 _refine.overall_SU_B 6.984 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 929 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 92 _refine_hist.number_atoms_total 1029 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 33.79 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.020 0.022 ? 984 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.605 1.982 ? 1339 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.365 5.000 ? 131 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.018 25.435 ? 46 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.601 15.000 ? 176 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 13.223 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.101 0.200 ? 157 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 748 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.202 0.200 ? 486 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.297 0.200 ? 689 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.155 0.200 ? 60 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.214 0.200 ? 44 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.223 0.200 ? 18 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.254 1.500 ? 650 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.558 2.000 ? 999 'X-RAY DIFFRACTION' ? r_scbond_it 3.622 3.000 ? 375 'X-RAY DIFFRACTION' ? r_scangle_it 4.779 4.500 ? 334 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.05 _refine_ls_shell.number_reflns_R_work 663 _refine_ls_shell.R_factor_R_work 0.197 _refine_ls_shell.percent_reflns_obs 99.00 _refine_ls_shell.R_factor_R_free 0.265 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2I9C _struct.title 'Crystal Structure of the Protein RPA1889 from Rhodopseudomonas palustris CGA009' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2I9C _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'Structural Genomics, SAD, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 10 ? GLY A 31 ? THR A 10 GLY A 31 1 ? 22 HELX_P HELX_P2 2 GLN A 33 ? ARG A 54 ? GLN A 33 ARG A 54 1 ? 22 HELX_P HELX_P3 3 ASP A 57 ? TYR A 68 ? ASP A 57 TYR A 68 5 ? 12 HELX_P HELX_P4 4 ASN A 70 ? LEU A 80 ? ASN A 70 LEU A 80 1 ? 11 HELX_P HELX_P5 5 ALA A 85 ? LYS A 100 ? ALA A 85 LYS A 100 1 ? 16 HELX_P HELX_P6 6 PRO A 103 ? GLY A 118 ? PRO A 103 GLY A 118 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLN 8 C ? ? ? 1_555 A MSE 9 N ? ? A GLN 8 A MSE 9 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A MSE 9 C ? ? ? 1_555 A THR 10 N ? ? A MSE 9 A THR 10 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? A VAL 43 C ? ? ? 1_555 A MSE 44 N ? ? A VAL 43 A MSE 44 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale4 covale both ? A MSE 44 C ? ? ? 1_555 A ALA 45 N ? ? A MSE 44 A ALA 45 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale5 covale both ? A ASN 70 C ? ? ? 1_555 A MSE 71 N ? ? A ASN 70 A MSE 71 1_555 ? ? ? ? ? ? ? 1.315 ? ? covale6 covale both ? A MSE 71 C ? ? ? 1_555 A GLN 72 N ? ? A MSE 71 A GLN 72 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale7 covale both ? A GLY 109 C ? ? ? 1_555 A MSE 110 N ? ? A GLY 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale8 covale both ? A MSE 110 C ? ? ? 1_555 A CYS 111 N ? ? A MSE 110 A CYS 111 1_555 ? ? ? ? ? ? ? 1.341 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 102 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 102 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 103 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 103 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.28 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ACT 124 ? 7 'BINDING SITE FOR RESIDUE ACT A 124' AC2 Software A ACT 125 ? 4 'BINDING SITE FOR RESIDUE ACT A 125' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 MSE A 71 ? MSE A 71 . ? 1_555 ? 2 AC1 7 ARG A 74 ? ARG A 74 . ? 1_555 ? 3 AC1 7 GLN A 92 ? GLN A 92 . ? 1_555 ? 4 AC1 7 ALA A 95 ? ALA A 95 . ? 1_555 ? 5 AC1 7 ILE A 96 ? ILE A 96 . ? 1_555 ? 6 AC1 7 SER A 99 ? SER A 99 . ? 1_555 ? 7 AC1 7 SER A 99 ? SER A 99 . ? 6_555 ? 8 AC2 4 ALA A 85 ? ALA A 85 . ? 1_555 ? 9 AC2 4 PRO A 86 ? PRO A 86 . ? 1_555 ? 10 AC2 4 VAL A 87 ? VAL A 87 . ? 1_555 ? 11 AC2 4 LYS A 88 ? LYS A 88 . ? 1_555 ? # _database_PDB_matrix.entry_id 2I9C _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2I9C _atom_sites.fract_transf_matrix[1][1] 0.012817 _atom_sites.fract_transf_matrix[1][2] 0.007400 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014800 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025655 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 MSE 9 9 9 MSE MSE A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MSE 44 44 44 MSE MSE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 MSE 71 71 71 MSE MSE A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 MSE 110 110 110 MSE MSE A . n A 1 111 CYS 111 111 111 CYS CYS A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 LYS 123 123 123 LYS LYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 124 1 ACT ACT A . C 2 ACT 1 125 2 ACT ACT A . D 3 HOH 1 126 4 HOH HOH A . D 3 HOH 2 127 5 HOH HOH A . D 3 HOH 3 128 6 HOH HOH A . D 3 HOH 4 129 7 HOH HOH A . D 3 HOH 5 130 9 HOH HOH A . D 3 HOH 6 131 10 HOH HOH A . D 3 HOH 7 132 11 HOH HOH A . D 3 HOH 8 133 13 HOH HOH A . D 3 HOH 9 134 14 HOH HOH A . D 3 HOH 10 135 15 HOH HOH A . D 3 HOH 11 136 16 HOH HOH A . D 3 HOH 12 137 17 HOH HOH A . D 3 HOH 13 138 18 HOH HOH A . D 3 HOH 14 139 19 HOH HOH A . D 3 HOH 15 140 20 HOH HOH A . D 3 HOH 16 141 21 HOH HOH A . D 3 HOH 17 142 22 HOH HOH A . D 3 HOH 18 143 23 HOH HOH A . D 3 HOH 19 144 24 HOH HOH A . D 3 HOH 20 145 25 HOH HOH A . D 3 HOH 21 146 26 HOH HOH A . D 3 HOH 22 147 27 HOH HOH A . D 3 HOH 23 148 28 HOH HOH A . D 3 HOH 24 149 29 HOH HOH A . D 3 HOH 25 150 30 HOH HOH A . D 3 HOH 26 151 31 HOH HOH A . D 3 HOH 27 152 32 HOH HOH A . D 3 HOH 28 153 33 HOH HOH A . D 3 HOH 29 154 34 HOH HOH A . D 3 HOH 30 155 36 HOH HOH A . D 3 HOH 31 156 37 HOH HOH A . D 3 HOH 32 157 38 HOH HOH A . D 3 HOH 33 158 39 HOH HOH A . D 3 HOH 34 159 40 HOH HOH A . D 3 HOH 35 160 41 HOH HOH A . D 3 HOH 36 161 42 HOH HOH A . D 3 HOH 37 162 43 HOH HOH A . D 3 HOH 38 163 44 HOH HOH A . D 3 HOH 39 164 46 HOH HOH A . D 3 HOH 40 165 47 HOH HOH A . D 3 HOH 41 166 48 HOH HOH A . D 3 HOH 42 167 49 HOH HOH A . D 3 HOH 43 168 50 HOH HOH A . D 3 HOH 44 169 51 HOH HOH A . D 3 HOH 45 170 52 HOH HOH A . D 3 HOH 46 171 53 HOH HOH A . D 3 HOH 47 172 54 HOH HOH A . D 3 HOH 48 173 55 HOH HOH A . D 3 HOH 49 174 57 HOH HOH A . D 3 HOH 50 175 58 HOH HOH A . D 3 HOH 51 176 59 HOH HOH A . D 3 HOH 52 177 62 HOH HOH A . D 3 HOH 53 178 63 HOH HOH A . D 3 HOH 54 179 65 HOH HOH A . D 3 HOH 55 180 68 HOH HOH A . D 3 HOH 56 181 69 HOH HOH A . D 3 HOH 57 182 70 HOH HOH A . D 3 HOH 58 183 71 HOH HOH A . D 3 HOH 59 184 75 HOH HOH A . D 3 HOH 60 185 76 HOH HOH A . D 3 HOH 61 186 77 HOH HOH A . D 3 HOH 62 187 78 HOH HOH A . D 3 HOH 63 188 79 HOH HOH A . D 3 HOH 64 189 80 HOH HOH A . D 3 HOH 65 190 81 HOH HOH A . D 3 HOH 66 191 83 HOH HOH A . D 3 HOH 67 192 84 HOH HOH A . D 3 HOH 68 193 85 HOH HOH A . D 3 HOH 69 194 86 HOH HOH A . D 3 HOH 70 195 87 HOH HOH A . D 3 HOH 71 196 88 HOH HOH A . D 3 HOH 72 197 89 HOH HOH A . D 3 HOH 73 198 90 HOH HOH A . D 3 HOH 74 199 91 HOH HOH A . D 3 HOH 75 200 93 HOH HOH A . D 3 HOH 76 201 94 HOH HOH A . D 3 HOH 77 202 95 HOH HOH A . D 3 HOH 78 203 104 HOH HOH A . D 3 HOH 79 204 109 HOH HOH A . D 3 HOH 80 205 111 HOH HOH A . D 3 HOH 81 206 112 HOH HOH A . D 3 HOH 82 207 113 HOH HOH A . D 3 HOH 83 208 114 HOH HOH A . D 3 HOH 84 209 116 HOH HOH A . D 3 HOH 85 210 117 HOH HOH A . D 3 HOH 86 211 119 HOH HOH A . D 3 HOH 87 212 120 HOH HOH A . D 3 HOH 88 213 121 HOH HOH A . D 3 HOH 89 214 122 HOH HOH A . D 3 HOH 90 215 125 HOH HOH A . D 3 HOH 91 216 126 HOH HOH A . D 3 HOH 92 217 127 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 9 A MSE 9 ? MET SELENOMETHIONINE 2 A MSE 44 A MSE 44 ? MET SELENOMETHIONINE 3 A MSE 71 A MSE 71 ? MET SELENOMETHIONINE 4 A MSE 110 A MSE 110 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 160 ? D HOH . 2 1 A HOH 164 ? D HOH . 3 1 A HOH 170 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-03 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-10-05 5 'Structure model' 1 4 2022-04-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Structure summary' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' audit_author 2 5 'Structure model' citation_author 3 5 'Structure model' database_2 4 5 'Structure model' struct_conn 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_audit_author.identifier_ORCID' 2 5 'Structure model' '_citation_author.identifier_ORCID' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 5 'Structure model' '_struct_ref_seq_dif.details' 7 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -14.1680 _pdbx_refine_tls.origin_y 45.4950 _pdbx_refine_tls.origin_z 2.9100 _pdbx_refine_tls.T[1][1] -0.1750 _pdbx_refine_tls.T[2][2] -0.0520 _pdbx_refine_tls.T[3][3] -0.0556 _pdbx_refine_tls.T[1][2] -0.0681 _pdbx_refine_tls.T[1][3] 0.0121 _pdbx_refine_tls.T[2][3] -0.0116 _pdbx_refine_tls.L[1][1] 1.0989 _pdbx_refine_tls.L[2][2] 1.8961 _pdbx_refine_tls.L[3][3] 4.2714 _pdbx_refine_tls.L[1][2] 0.4093 _pdbx_refine_tls.L[1][3] -0.0113 _pdbx_refine_tls.L[2][3] 0.4471 _pdbx_refine_tls.S[1][1] -0.0018 _pdbx_refine_tls.S[1][2] 0.1088 _pdbx_refine_tls.S[1][3] 0.0373 _pdbx_refine_tls.S[2][1] -0.0876 _pdbx_refine_tls.S[2][2] 0.1436 _pdbx_refine_tls.S[2][3] 0.0793 _pdbx_refine_tls.S[3][1] -0.3067 _pdbx_refine_tls.S[3][2] 0.5140 _pdbx_refine_tls.S[3][3] -0.1418 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 4 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 4 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 123 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 123 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 HKL-2000 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 HKL-3000 phasing . ? 5 SHELXD phasing . ? 6 SHELXE 'model building' . ? 7 MLPHARE phasing . ? 8 DM phasing . ? 9 CCP4 phasing . ? 10 SOLVE phasing . ? 11 RESOLVE phasing . ? 12 ARP/wARP 'model building' . ? 13 Coot 'model building' . ? 14 O 'model building' . ? 15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 57 ? ? 63.49 91.44 2 1 ALA A 85 ? ? -152.29 68.51 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PRO _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 122 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LYS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 123 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 89.76 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 3 ? CG ? A LYS 3 CG 2 1 Y 1 A LYS 3 ? CD ? A LYS 3 CD 3 1 Y 1 A LYS 3 ? CE ? A LYS 3 CE 4 1 Y 1 A LYS 3 ? NZ ? A LYS 3 NZ 5 1 Y 1 A LYS 121 ? CG ? A LYS 121 CG 6 1 Y 1 A LYS 121 ? CD ? A LYS 121 CD 7 1 Y 1 A LYS 121 ? CE ? A LYS 121 CE 8 1 Y 1 A LYS 121 ? NZ ? A LYS 121 NZ 9 1 Y 1 A LYS 123 ? CB ? A LYS 123 CB 10 1 Y 1 A LYS 123 ? CG ? A LYS 123 CG 11 1 Y 1 A LYS 123 ? CD ? A LYS 123 CD 12 1 Y 1 A LYS 123 ? CE ? A LYS 123 CE 13 1 Y 1 A LYS 123 ? NZ ? A LYS 123 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 2 ? A SER 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 water HOH #