data_2I9H # _entry.id 2I9H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2I9H pdb_00002i9h 10.2210/pdb2i9h/pdb RCSB RCSB039305 ? ? WWPDB D_1000039305 ? ? BMRB 6912 ? 10.13018/BMR6912 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-17 2 'Structure model' 1 1 2008-02-13 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-19 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Database references' 7 5 'Structure model' Other 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_database_status 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond 9 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.entry_id 2I9H _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-09-05 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 6912 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pinheiro, A.S.' 1 'Amorim, G.C.' 2 'Almeida, F.C.L.' 3 'Valente, A.P.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR solution structure of the reduced form of thioredoxin 1 from Sacharomyces cerevisiae' Proteins 70 584 587 2008 PSFGEY US 0887-3585 0867 ? 17932921 10.1002/prot.21693 1 '(1)H, (13)C and (15)N Resonance Assignments for the Reduced Forms of Thioredoxin 1 and 2 from S. cerevisiae' J.BIOMOL.NMR ? ? ? 2006 JBNME9 NE 0925-2738 0800 ? 16609834 10.1007/s10858-006-0025-7 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pinheiro, A.S.' 1 ? primary 'Amorim, G.C.' 2 ? primary 'Netto, L.E.' 3 ? primary 'Almeida, F.C.' 4 ? primary 'Valente, A.P.' 5 ? 1 'Pinheiro, A.S.' 6 ? 1 'Amorim, G.C.' 7 ? 1 'Netto, L.E.' 8 ? 1 'Almeida, F.C.' 9 ? 1 'Valente, A.P.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Thioredoxin I' _entity.formula_weight 11244.933 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Thioredoxin isoform 1, TR-I, Thioredoxin 2,' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKN GKEVAKVVGANPAAIKQAIAANA ; _entity_poly.pdbx_seq_one_letter_code_can ;MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKN GKEVAKVVGANPAAIKQAIAANA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 THR n 1 4 GLN n 1 5 PHE n 1 6 LYS n 1 7 THR n 1 8 ALA n 1 9 SER n 1 10 GLU n 1 11 PHE n 1 12 ASP n 1 13 SER n 1 14 ALA n 1 15 ILE n 1 16 ALA n 1 17 GLN n 1 18 ASP n 1 19 LYS n 1 20 LEU n 1 21 VAL n 1 22 VAL n 1 23 VAL n 1 24 ASP n 1 25 PHE n 1 26 TYR n 1 27 ALA n 1 28 THR n 1 29 TRP n 1 30 CYS n 1 31 GLY n 1 32 PRO n 1 33 CYS n 1 34 LYS n 1 35 MET n 1 36 ILE n 1 37 ALA n 1 38 PRO n 1 39 MET n 1 40 ILE n 1 41 GLU n 1 42 LYS n 1 43 PHE n 1 44 SER n 1 45 GLU n 1 46 GLN n 1 47 TYR n 1 48 PRO n 1 49 GLN n 1 50 ALA n 1 51 ASP n 1 52 PHE n 1 53 TYR n 1 54 LYS n 1 55 LEU n 1 56 ASP n 1 57 VAL n 1 58 ASP n 1 59 GLU n 1 60 LEU n 1 61 GLY n 1 62 ASP n 1 63 VAL n 1 64 ALA n 1 65 GLN n 1 66 LYS n 1 67 ASN n 1 68 GLU n 1 69 VAL n 1 70 SER n 1 71 ALA n 1 72 MET n 1 73 PRO n 1 74 THR n 1 75 LEU n 1 76 LEU n 1 77 LEU n 1 78 PHE n 1 79 LYS n 1 80 ASN n 1 81 GLY n 1 82 LYS n 1 83 GLU n 1 84 VAL n 1 85 ALA n 1 86 LYS n 1 87 VAL n 1 88 VAL n 1 89 GLY n 1 90 ALA n 1 91 ASN n 1 92 PRO n 1 93 ALA n 1 94 ALA n 1 95 ILE n 1 96 LYS n 1 97 GLN n 1 98 ALA n 1 99 ILE n 1 100 ALA n 1 101 ALA n 1 102 ASN n 1 103 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene 'TRX1, TRX2, YLR043C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET17b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ALA 103 103 103 ALA ALA A . n # _cell.entry_id 2I9H _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2I9H _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2I9H _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2I9H _struct.title 'NMR solution structure of the reduced form of thioredoxin 1 from yeast (Trx1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2I9H _struct_keywords.text 'thioredoxin, yeast, oxireductase, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRX1_YEAST _struct_ref.pdbx_db_accession P22217 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNG KEVAKVVGANPAAIKQAIAANA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2I9H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22217 _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 7 ? ALA A 16 ? THR A 7 ALA A 16 1 ? 10 HELX_P HELX_P2 2 MET A 35 ? PHE A 43 ? MET A 35 PHE A 43 1 ? 9 HELX_P HELX_P3 3 SER A 44 ? GLN A 46 ? SER A 44 GLN A 46 5 ? 3 HELX_P HELX_P4 4 LEU A 60 ? ASN A 67 ? LEU A 60 ASN A 67 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 1 -0.20 2 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 2 -0.44 3 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 3 -0.31 4 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 4 0.21 5 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 5 -0.90 6 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 6 -0.19 7 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 7 -0.51 8 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 8 -0.30 9 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 9 -0.37 10 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 10 0.01 11 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 11 -0.21 12 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 12 -0.22 13 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 13 -0.52 14 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 14 -0.48 15 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 15 -0.34 16 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 16 -0.27 17 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 17 -0.68 18 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 18 -0.88 19 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 19 -0.11 20 MET 72 A . ? MET 72 A PRO 73 A ? PRO 73 A 20 -0.38 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 20 ? ASP A 24 ? LEU A 20 ASP A 24 A 2 LEU A 75 ? LYS A 79 ? LEU A 75 LYS A 79 A 3 ALA A 85 ? LYS A 86 ? ALA A 85 LYS A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 23 ? N VAL A 23 O LEU A 76 ? O LEU A 76 A 2 3 N LEU A 77 ? N LEU A 77 O ALA A 85 ? O ALA A 85 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A ALA 98 ? ? HD21 A ASN 102 ? ? 1.60 2 9 O A ILE 36 ? ? H A ILE 40 ? ? 1.56 3 13 O A ILE 36 ? ? H A ILE 40 ? ? 1.57 4 13 O A ASP 24 ? ? H A LEU 55 ? ? 1.59 5 16 O A ILE 36 ? ? H A ILE 40 ? ? 1.60 6 18 O A ASP 24 ? ? H A LEU 55 ? ? 1.57 7 20 O A TYR 47 ? ? H A ALA 50 ? ? 1.53 8 20 O A ALA 98 ? ? HD21 A ASN 102 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 10 ? ? -90.42 -64.94 2 1 ALA A 16 ? ? -40.74 95.43 3 1 GLN A 17 ? ? 44.35 86.66 4 1 ASP A 18 ? ? -169.54 41.14 5 1 LYS A 19 ? ? 67.56 -155.41 6 1 PHE A 25 ? ? -98.98 51.60 7 1 TRP A 29 ? ? -106.61 -128.74 8 1 CYS A 30 ? ? 61.08 156.08 9 1 ALA A 71 ? ? -60.90 -157.90 10 1 MET A 72 ? ? -169.75 88.19 11 1 LYS A 82 ? ? -127.33 -160.82 12 1 VAL A 84 ? ? -162.38 -47.04 13 1 VAL A 88 ? ? -62.33 98.04 14 1 ALA A 90 ? ? -95.68 37.13 15 1 PRO A 92 ? ? -45.91 86.61 16 1 ALA A 93 ? ? 178.51 -36.80 17 1 ILE A 95 ? ? -49.94 -18.44 18 1 ALA A 100 ? ? -90.26 -69.39 19 2 VAL A 2 ? ? 52.03 131.86 20 2 ALA A 16 ? ? -46.29 103.74 21 2 GLN A 17 ? ? 44.01 87.45 22 2 ASP A 18 ? ? -168.84 40.67 23 2 LYS A 19 ? ? 64.33 -156.88 24 2 PHE A 25 ? ? -98.89 48.69 25 2 TRP A 29 ? ? -141.76 -38.71 26 2 PRO A 48 ? ? -37.74 -32.32 27 2 VAL A 69 ? ? -115.25 68.99 28 2 ALA A 71 ? ? -57.56 -166.53 29 2 MET A 72 ? ? -174.43 107.43 30 2 LYS A 82 ? ? -115.57 -153.55 31 2 VAL A 84 ? ? -144.00 -59.82 32 2 VAL A 88 ? ? -59.64 85.67 33 2 ALA A 94 ? ? -152.39 -62.02 34 2 ILE A 95 ? ? -58.17 -5.45 35 2 ALA A 100 ? ? -90.64 -77.69 36 3 ALA A 16 ? ? -43.14 97.23 37 3 GLN A 17 ? ? 45.35 88.86 38 3 ASP A 18 ? ? -170.00 39.83 39 3 LYS A 19 ? ? 68.18 -154.35 40 3 PHE A 25 ? ? -98.90 50.88 41 3 CYS A 30 ? ? -28.51 -75.19 42 3 LEU A 60 ? ? -104.74 -69.08 43 3 VAL A 69 ? ? -114.75 69.12 44 3 ALA A 71 ? ? -55.32 -172.07 45 3 MET A 72 ? ? -171.59 107.57 46 3 LYS A 82 ? ? -122.12 -158.86 47 3 VAL A 84 ? ? -165.01 -46.17 48 3 VAL A 88 ? ? -66.78 97.87 49 3 ALA A 90 ? ? -96.98 35.87 50 3 PRO A 92 ? ? -44.79 87.34 51 3 ALA A 93 ? ? 178.76 -36.24 52 3 ALA A 100 ? ? -90.62 -65.64 53 4 ALA A 16 ? ? -43.10 97.11 54 4 GLN A 17 ? ? 45.65 86.92 55 4 ASP A 18 ? ? -167.36 41.04 56 4 LYS A 19 ? ? 63.31 -156.67 57 4 PHE A 25 ? ? -99.39 46.78 58 4 TRP A 29 ? ? -96.28 -126.46 59 4 CYS A 30 ? ? 48.67 -88.68 60 4 PRO A 48 ? ? -39.19 -31.85 61 4 VAL A 69 ? ? -107.72 54.20 62 4 VAL A 84 ? ? -162.76 -47.24 63 4 VAL A 88 ? ? -61.52 84.61 64 4 ALA A 93 ? ? -115.22 53.12 65 4 ALA A 94 ? ? -167.69 -56.70 66 4 ILE A 95 ? ? -54.72 -9.78 67 4 ALA A 100 ? ? -90.28 -62.52 68 5 ALA A 16 ? ? -43.69 97.75 69 5 GLN A 17 ? ? 44.52 86.84 70 5 ASP A 18 ? ? -169.32 40.78 71 5 LYS A 19 ? ? 67.66 -156.64 72 5 PHE A 25 ? ? -99.08 52.09 73 5 TRP A 29 ? ? -110.13 -132.33 74 5 CYS A 30 ? ? 62.20 -79.66 75 5 PRO A 48 ? ? -37.63 -38.66 76 5 ALA A 71 ? ? -98.86 34.44 77 5 MET A 72 ? ? -21.76 119.77 78 5 LYS A 82 ? ? -125.55 -156.13 79 5 VAL A 84 ? ? -162.19 -59.80 80 5 VAL A 88 ? ? -60.71 88.72 81 5 ALA A 94 ? ? -164.21 -53.05 82 5 ILE A 95 ? ? -49.20 -16.94 83 5 ALA A 100 ? ? -90.18 -62.92 84 6 ALA A 16 ? ? -41.48 95.48 85 6 GLN A 17 ? ? 45.73 92.06 86 6 ASP A 18 ? ? -174.70 39.82 87 6 LYS A 19 ? ? 64.97 -155.61 88 6 PHE A 25 ? ? -99.25 54.41 89 6 CYS A 30 ? ? -46.96 159.19 90 6 PRO A 48 ? ? -39.38 -31.99 91 6 LEU A 60 ? ? -93.62 51.86 92 6 ALA A 71 ? ? -73.02 -149.13 93 6 MET A 72 ? ? -175.88 84.73 94 6 PRO A 73 ? ? -95.76 -156.28 95 6 LYS A 82 ? ? -126.91 -158.48 96 6 VAL A 84 ? ? -164.54 -47.79 97 6 VAL A 88 ? ? -50.27 94.19 98 6 ALA A 90 ? ? -95.60 35.86 99 6 ASN A 91 ? ? -59.04 108.04 100 6 PRO A 92 ? ? -33.02 90.37 101 6 ALA A 93 ? ? 172.97 -30.65 102 6 ILE A 95 ? ? -49.35 -19.07 103 6 LYS A 96 ? ? -91.20 -66.17 104 6 ALA A 100 ? ? -90.44 -68.68 105 7 ALA A 16 ? ? -42.95 101.90 106 7 GLN A 17 ? ? 43.78 86.10 107 7 ASP A 18 ? ? -166.24 39.26 108 7 LYS A 19 ? ? 65.37 -153.29 109 7 PHE A 25 ? ? -98.88 50.42 110 7 CYS A 30 ? ? 4.07 -80.95 111 7 PRO A 48 ? ? -38.59 -29.03 112 7 LEU A 60 ? ? -119.72 59.92 113 7 VAL A 69 ? ? -83.45 -77.39 114 7 SER A 70 ? ? 47.91 25.45 115 7 ALA A 71 ? ? -98.91 -159.82 116 7 MET A 72 ? ? -172.74 90.40 117 7 LYS A 82 ? ? -111.71 -156.81 118 7 VAL A 84 ? ? -146.64 -62.22 119 7 VAL A 88 ? ? -57.18 95.11 120 7 ALA A 90 ? ? -98.66 33.85 121 7 PRO A 92 ? ? -31.91 88.46 122 7 ALA A 93 ? ? 176.17 -35.26 123 7 ALA A 100 ? ? -90.38 -65.29 124 7 ASN A 102 ? ? -90.07 -67.79 125 8 ALA A 16 ? ? -40.06 95.48 126 8 GLN A 17 ? ? 39.19 85.06 127 8 ASP A 18 ? ? -162.49 40.52 128 8 LYS A 19 ? ? 67.20 -156.52 129 8 PHE A 25 ? ? -98.99 48.57 130 8 TRP A 29 ? ? -127.35 -125.30 131 8 CYS A 30 ? ? 62.49 -77.58 132 8 PRO A 48 ? ? -39.76 -31.62 133 8 ALA A 71 ? ? -61.01 -157.75 134 8 MET A 72 ? ? -175.26 100.92 135 8 LYS A 82 ? ? -132.34 -159.55 136 8 VAL A 84 ? ? -163.75 -49.05 137 8 VAL A 88 ? ? -61.66 83.94 138 8 ALA A 90 ? ? -95.36 37.76 139 8 PRO A 92 ? ? -46.70 86.32 140 8 ALA A 93 ? ? 174.35 -35.88 141 8 ALA A 100 ? ? -90.38 -70.51 142 9 GLN A 17 ? ? 48.14 91.76 143 9 ASP A 18 ? ? -168.91 39.62 144 9 LYS A 19 ? ? 76.12 -156.83 145 9 PHE A 25 ? ? -99.06 49.48 146 9 VAL A 57 ? ? -93.14 42.71 147 9 ASP A 58 ? ? -152.97 -48.78 148 9 LEU A 60 ? ? -103.16 -64.43 149 9 VAL A 69 ? ? -107.37 74.60 150 9 ALA A 71 ? ? -58.14 -163.73 151 9 MET A 72 ? ? -178.10 106.64 152 9 ASN A 80 ? ? 43.90 82.46 153 9 LYS A 82 ? ? -146.97 -158.73 154 9 VAL A 84 ? ? -145.08 -69.08 155 9 VAL A 87 ? ? -154.60 78.87 156 9 VAL A 88 ? ? -58.73 90.21 157 9 ALA A 90 ? ? -87.85 47.37 158 9 PRO A 92 ? ? -33.20 -31.79 159 9 ALA A 93 ? ? -95.49 30.49 160 9 ALA A 94 ? ? -152.34 -60.13 161 9 ALA A 100 ? ? -90.09 -68.62 162 10 ALA A 16 ? ? -43.55 98.75 163 10 GLN A 17 ? ? 45.58 90.49 164 10 ASP A 18 ? ? -171.42 39.50 165 10 LYS A 19 ? ? 63.54 -154.98 166 10 PHE A 25 ? ? -98.96 49.45 167 10 PRO A 48 ? ? -39.26 -31.51 168 10 ALA A 71 ? ? -77.83 -154.74 169 10 MET A 72 ? ? -171.46 87.12 170 10 PRO A 73 ? ? -96.35 -156.30 171 10 LYS A 82 ? ? -128.94 -157.00 172 10 VAL A 84 ? ? -151.09 -55.70 173 10 ALA A 85 ? ? -170.13 -164.24 174 10 ALA A 94 ? ? -137.50 -57.32 175 10 ALA A 100 ? ? -88.57 -71.78 176 11 ALA A 16 ? ? -45.58 101.97 177 11 GLN A 17 ? ? 44.78 89.08 178 11 ASP A 18 ? ? -171.72 40.42 179 11 LYS A 19 ? ? 62.45 -156.67 180 11 PHE A 25 ? ? -99.35 53.21 181 11 TRP A 29 ? ? -109.12 -125.98 182 11 CYS A 30 ? ? 61.58 -82.24 183 11 PRO A 48 ? ? -34.94 -33.93 184 11 VAL A 69 ? ? -110.44 78.37 185 11 ALA A 71 ? ? -61.46 -156.75 186 11 MET A 72 ? ? -176.68 86.93 187 11 PRO A 73 ? ? -98.06 -159.58 188 11 LYS A 82 ? ? -115.62 -153.76 189 11 VAL A 84 ? ? -146.45 -64.59 190 11 ALA A 90 ? ? -96.31 36.99 191 11 PRO A 92 ? ? -46.95 87.66 192 11 ALA A 93 ? ? -179.54 -38.26 193 11 ALA A 100 ? ? -90.47 -74.26 194 12 VAL A 2 ? ? 66.64 123.89 195 12 ALA A 16 ? ? -41.93 97.86 196 12 GLN A 17 ? ? 45.77 88.52 197 12 ASP A 18 ? ? -170.37 41.07 198 12 LYS A 19 ? ? 66.17 -155.49 199 12 PHE A 25 ? ? -99.08 51.37 200 12 TRP A 29 ? ? -138.53 -43.62 201 12 PRO A 32 ? ? -67.76 -145.82 202 12 LEU A 60 ? ? -101.82 46.68 203 12 ALA A 71 ? ? -59.49 -163.07 204 12 MET A 72 ? ? -173.82 94.39 205 12 LYS A 82 ? ? -115.18 -155.85 206 12 VAL A 84 ? ? -147.79 -68.38 207 12 VAL A 88 ? ? -60.89 85.14 208 12 ALA A 90 ? ? -96.79 38.45 209 12 PRO A 92 ? ? -45.62 88.85 210 12 ALA A 93 ? ? 172.52 -33.16 211 12 ALA A 100 ? ? -90.20 -69.65 212 13 VAL A 2 ? ? -178.04 139.73 213 13 ALA A 16 ? ? -43.07 103.00 214 13 GLN A 17 ? ? 45.18 92.11 215 13 ASP A 18 ? ? -171.51 38.51 216 13 LYS A 19 ? ? 61.61 -152.50 217 13 PHE A 25 ? ? -99.07 53.01 218 13 TRP A 29 ? ? -141.53 -38.05 219 13 CYS A 30 ? ? -35.21 150.98 220 13 PRO A 32 ? ? -73.01 -76.90 221 13 CYS A 33 ? ? 37.92 31.33 222 13 LYS A 34 ? ? -132.04 -35.98 223 13 PRO A 48 ? ? -36.91 -33.03 224 13 LEU A 60 ? ? -97.76 44.85 225 13 VAL A 69 ? ? -111.45 68.35 226 13 ALA A 71 ? ? -59.76 -161.57 227 13 MET A 72 ? ? -173.71 89.46 228 13 LYS A 82 ? ? -110.93 -155.37 229 13 VAL A 84 ? ? -146.18 -68.01 230 13 ALA A 85 ? ? -170.39 -168.31 231 13 VAL A 87 ? ? -154.46 82.41 232 13 ALA A 94 ? ? -139.67 -59.57 233 13 ILE A 95 ? ? -57.02 -7.28 234 13 ALA A 100 ? ? -90.84 -71.22 235 14 SER A 9 ? ? 160.55 -24.97 236 14 ALA A 16 ? ? -43.62 95.89 237 14 GLN A 17 ? ? 45.23 83.17 238 14 ASP A 18 ? ? -164.67 42.25 239 14 LYS A 19 ? ? 64.86 -157.20 240 14 PHE A 25 ? ? -99.15 48.29 241 14 PRO A 48 ? ? -37.41 -32.43 242 14 VAL A 57 ? ? -93.38 30.33 243 14 ASP A 58 ? ? -137.94 -46.73 244 14 LEU A 60 ? ? -118.52 72.78 245 14 ALA A 71 ? ? -55.99 -171.01 246 14 MET A 72 ? ? -167.84 108.31 247 14 VAL A 84 ? ? -164.20 -46.98 248 14 ALA A 90 ? ? -94.00 38.35 249 14 PRO A 92 ? ? -48.48 84.70 250 14 ALA A 93 ? ? 178.66 -38.79 251 14 ALA A 100 ? ? -90.47 -64.42 252 14 ASN A 102 ? ? -90.15 -66.42 253 15 VAL A 2 ? ? -177.31 127.61 254 15 ALA A 14 ? ? -56.39 -72.02 255 15 ALA A 16 ? ? -44.43 96.22 256 15 GLN A 17 ? ? 44.68 91.16 257 15 ASP A 18 ? ? -174.54 40.37 258 15 LYS A 19 ? ? 69.36 -158.26 259 15 PHE A 25 ? ? -99.14 54.60 260 15 PRO A 48 ? ? -38.01 -27.22 261 15 VAL A 69 ? ? -116.18 72.97 262 15 ALA A 71 ? ? -55.36 -172.62 263 15 MET A 72 ? ? -170.08 112.74 264 15 VAL A 84 ? ? -164.16 -47.44 265 15 VAL A 88 ? ? -68.03 78.68 266 15 ALA A 90 ? ? -97.11 38.53 267 15 PRO A 92 ? ? -45.52 87.65 268 15 ALA A 93 ? ? -179.60 -40.28 269 15 LYS A 96 ? ? -90.64 -66.76 270 15 ALA A 100 ? ? -90.43 -68.57 271 16 SER A 9 ? ? 160.26 -25.33 272 16 ALA A 16 ? ? -40.49 94.34 273 16 GLN A 17 ? ? 44.16 88.96 274 16 ASP A 18 ? ? -170.64 40.47 275 16 LYS A 19 ? ? 70.82 -151.47 276 16 PHE A 25 ? ? -99.10 49.39 277 16 CYS A 30 ? ? -46.58 158.72 278 16 PRO A 48 ? ? -37.18 -33.20 279 16 ALA A 71 ? ? -76.12 -153.06 280 16 MET A 72 ? ? -173.04 79.65 281 16 PRO A 73 ? ? -97.52 -155.61 282 16 LYS A 82 ? ? -122.50 -155.83 283 16 VAL A 84 ? ? -166.55 -47.88 284 16 LYS A 86 ? ? -170.05 115.57 285 16 VAL A 88 ? ? -59.92 88.22 286 16 ALA A 90 ? ? 158.54 39.42 287 16 PRO A 92 ? ? -49.75 -18.41 288 16 ALA A 94 ? ? -151.59 -60.06 289 16 ALA A 100 ? ? -90.40 -72.05 290 17 VAL A 2 ? ? 67.14 139.59 291 17 GLU A 10 ? ? -90.34 -62.59 292 17 ALA A 16 ? ? -43.37 102.84 293 17 GLN A 17 ? ? 44.50 87.52 294 17 ASP A 18 ? ? -168.37 39.36 295 17 LYS A 19 ? ? 62.54 -154.51 296 17 PHE A 25 ? ? -99.25 50.26 297 17 TRP A 29 ? ? -143.58 -42.24 298 17 CYS A 30 ? ? -29.97 -76.20 299 17 PRO A 48 ? ? -38.63 -32.45 300 17 ALA A 71 ? ? -55.48 -173.64 301 17 MET A 72 ? ? -172.76 119.38 302 17 LYS A 82 ? ? -111.74 -154.18 303 17 VAL A 84 ? ? -144.03 -66.76 304 17 VAL A 87 ? ? -154.49 81.68 305 17 VAL A 88 ? ? -61.74 85.38 306 17 PRO A 92 ? ? -44.37 87.81 307 17 ALA A 93 ? ? 173.26 -38.14 308 17 LYS A 96 ? ? -90.78 -63.06 309 17 ALA A 100 ? ? -90.32 -72.16 310 18 ALA A 16 ? ? -44.78 99.03 311 18 GLN A 17 ? ? 44.66 89.66 312 18 ASP A 18 ? ? -169.38 39.66 313 18 LYS A 19 ? ? 65.82 -154.56 314 18 PHE A 25 ? ? -99.12 50.18 315 18 CYS A 30 ? ? -39.47 156.33 316 18 PRO A 32 ? ? -66.72 61.92 317 18 PRO A 48 ? ? -38.18 -32.02 318 18 LEU A 60 ? ? -113.47 52.64 319 18 SER A 70 ? ? -149.87 18.69 320 18 MET A 72 ? ? 43.54 93.31 321 18 PRO A 73 ? ? -92.60 -156.43 322 18 ASN A 80 ? ? 46.26 75.43 323 18 LYS A 82 ? ? -143.51 -158.58 324 18 VAL A 84 ? ? -149.14 -66.07 325 18 ALA A 90 ? ? -94.41 37.58 326 18 PRO A 92 ? ? -40.73 89.68 327 18 ALA A 93 ? ? 179.56 -32.91 328 18 ALA A 94 ? ? -132.11 -42.47 329 18 LYS A 96 ? ? -92.02 -61.87 330 18 ALA A 100 ? ? -88.23 -75.78 331 19 ALA A 16 ? ? -44.30 100.63 332 19 GLN A 17 ? ? 44.98 90.19 333 19 ASP A 18 ? ? -173.66 40.41 334 19 LYS A 19 ? ? 63.92 -157.28 335 19 PHE A 25 ? ? -99.19 52.36 336 19 TRP A 29 ? ? -112.25 -123.83 337 19 CYS A 30 ? ? 60.74 -83.18 338 19 PRO A 48 ? ? -37.98 -32.79 339 19 VAL A 69 ? ? -111.61 75.19 340 19 ALA A 71 ? ? -60.68 -159.01 341 19 MET A 72 ? ? -174.98 93.20 342 19 PRO A 73 ? ? -94.04 -156.69 343 19 LYS A 82 ? ? -111.19 -153.92 344 19 VAL A 84 ? ? -149.18 -63.29 345 19 ALA A 90 ? ? 147.61 36.93 346 19 PRO A 92 ? ? -48.87 85.24 347 19 ALA A 93 ? ? -179.48 -37.25 348 19 ALA A 100 ? ? -90.43 -74.21 349 20 ALA A 16 ? ? -40.28 97.56 350 20 GLN A 17 ? ? 43.14 88.58 351 20 ASP A 18 ? ? -167.11 38.50 352 20 LYS A 19 ? ? 70.07 -155.46 353 20 PHE A 25 ? ? -99.11 49.13 354 20 TRP A 29 ? ? -148.82 -44.77 355 20 CYS A 30 ? ? -43.30 156.11 356 20 PRO A 48 ? ? -38.05 -32.16 357 20 LEU A 60 ? ? -108.23 52.79 358 20 VAL A 69 ? ? -113.16 63.51 359 20 ALA A 71 ? ? -56.79 -168.77 360 20 MET A 72 ? ? -174.29 111.82 361 20 LYS A 82 ? ? -120.01 -155.56 362 20 VAL A 84 ? ? -165.38 -47.37 363 20 VAL A 88 ? ? -69.55 69.38 364 20 ALA A 90 ? ? -95.96 38.00 365 20 PRO A 92 ? ? -48.40 86.33 366 20 ALA A 93 ? ? 176.80 -36.43 367 20 ALA A 100 ? ? -90.74 -65.49 # _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.entry_id 2I9H _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2I9H # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '13C/15N uniformly labeled, 20mM phosphate buffer pH 7.0, DTT 10mM, Sodium azide 3mM; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '15N uniformly labeled, 20mM phosphate buffer pH 7.0, DTT 10mM, Sodium azide 3mM; 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 'unlabeled, 20mM phosphate buffer pH 7.0, DTT 10mM, Sodium azide 3mM; 100% D2O' '100% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 7.0 '20 mM phosphate' . K 2 298 ambient 7.0 '20 mM phosphate' . K 3 298 ambient 7.0 '20 mM phosphate' . K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 2 2 3D_15N-separated_NOESY 3 3 3 '2D NOESY' 4 1 1 HNCA-J # _pdbx_nmr_details.entry_id 2I9H _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.method 'torsion angle simulated annealing' _pdbx_nmr_refine.details 'cartesian simulated annealing' _pdbx_nmr_refine.entry_id 2I9H _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 1.1 'structure solution' Brunger 1 CNS 1.1 refinement Brunger 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 ILE N N N N 110 ILE CA C N S 111 ILE C C N N 112 ILE O O N N 113 ILE CB C N S 114 ILE CG1 C N N 115 ILE CG2 C N N 116 ILE CD1 C N N 117 ILE OXT O N N 118 ILE H H N N 119 ILE H2 H N N 120 ILE HA H N N 121 ILE HB H N N 122 ILE HG12 H N N 123 ILE HG13 H N N 124 ILE HG21 H N N 125 ILE HG22 H N N 126 ILE HG23 H N N 127 ILE HD11 H N N 128 ILE HD12 H N N 129 ILE HD13 H N N 130 ILE HXT H N N 131 LEU N N N N 132 LEU CA C N S 133 LEU C C N N 134 LEU O O N N 135 LEU CB C N N 136 LEU CG C N N 137 LEU CD1 C N N 138 LEU CD2 C N N 139 LEU OXT O N N 140 LEU H H N N 141 LEU H2 H N N 142 LEU HA H N N 143 LEU HB2 H N N 144 LEU HB3 H N N 145 LEU HG H N N 146 LEU HD11 H N N 147 LEU HD12 H N N 148 LEU HD13 H N N 149 LEU HD21 H N N 150 LEU HD22 H N N 151 LEU HD23 H N N 152 LEU HXT H N N 153 LYS N N N N 154 LYS CA C N S 155 LYS C C N N 156 LYS O O N N 157 LYS CB C N N 158 LYS CG C N N 159 LYS CD C N N 160 LYS CE C N N 161 LYS NZ N N N 162 LYS OXT O N N 163 LYS H H N N 164 LYS H2 H N N 165 LYS HA H N N 166 LYS HB2 H N N 167 LYS HB3 H N N 168 LYS HG2 H N N 169 LYS HG3 H N N 170 LYS HD2 H N N 171 LYS HD3 H N N 172 LYS HE2 H N N 173 LYS HE3 H N N 174 LYS HZ1 H N N 175 LYS HZ2 H N N 176 LYS HZ3 H N N 177 LYS HXT H N N 178 MET N N N N 179 MET CA C N S 180 MET C C N N 181 MET O O N N 182 MET CB C N N 183 MET CG C N N 184 MET SD S N N 185 MET CE C N N 186 MET OXT O N N 187 MET H H N N 188 MET H2 H N N 189 MET HA H N N 190 MET HB2 H N N 191 MET HB3 H N N 192 MET HG2 H N N 193 MET HG3 H N N 194 MET HE1 H N N 195 MET HE2 H N N 196 MET HE3 H N N 197 MET HXT H N N 198 PHE N N N N 199 PHE CA C N S 200 PHE C C N N 201 PHE O O N N 202 PHE CB C N N 203 PHE CG C Y N 204 PHE CD1 C Y N 205 PHE CD2 C Y N 206 PHE CE1 C Y N 207 PHE CE2 C Y N 208 PHE CZ C Y N 209 PHE OXT O N N 210 PHE H H N N 211 PHE H2 H N N 212 PHE HA H N N 213 PHE HB2 H N N 214 PHE HB3 H N N 215 PHE HD1 H N N 216 PHE HD2 H N N 217 PHE HE1 H N N 218 PHE HE2 H N N 219 PHE HZ H N N 220 PHE HXT H N N 221 PRO N N N N 222 PRO CA C N S 223 PRO C C N N 224 PRO O O N N 225 PRO CB C N N 226 PRO CG C N N 227 PRO CD C N N 228 PRO OXT O N N 229 PRO H H N N 230 PRO HA H N N 231 PRO HB2 H N N 232 PRO HB3 H N N 233 PRO HG2 H N N 234 PRO HG3 H N N 235 PRO HD2 H N N 236 PRO HD3 H N N 237 PRO HXT H N N 238 SER N N N N 239 SER CA C N S 240 SER C C N N 241 SER O O N N 242 SER CB C N N 243 SER OG O N N 244 SER OXT O N N 245 SER H H N N 246 SER H2 H N N 247 SER HA H N N 248 SER HB2 H N N 249 SER HB3 H N N 250 SER HG H N N 251 SER HXT H N N 252 THR N N N N 253 THR CA C N S 254 THR C C N N 255 THR O O N N 256 THR CB C N R 257 THR OG1 O N N 258 THR CG2 C N N 259 THR OXT O N N 260 THR H H N N 261 THR H2 H N N 262 THR HA H N N 263 THR HB H N N 264 THR HG1 H N N 265 THR HG21 H N N 266 THR HG22 H N N 267 THR HG23 H N N 268 THR HXT H N N 269 TRP N N N N 270 TRP CA C N S 271 TRP C C N N 272 TRP O O N N 273 TRP CB C N N 274 TRP CG C Y N 275 TRP CD1 C Y N 276 TRP CD2 C Y N 277 TRP NE1 N Y N 278 TRP CE2 C Y N 279 TRP CE3 C Y N 280 TRP CZ2 C Y N 281 TRP CZ3 C Y N 282 TRP CH2 C Y N 283 TRP OXT O N N 284 TRP H H N N 285 TRP H2 H N N 286 TRP HA H N N 287 TRP HB2 H N N 288 TRP HB3 H N N 289 TRP HD1 H N N 290 TRP HE1 H N N 291 TRP HE3 H N N 292 TRP HZ2 H N N 293 TRP HZ3 H N N 294 TRP HH2 H N N 295 TRP HXT H N N 296 TYR N N N N 297 TYR CA C N S 298 TYR C C N N 299 TYR O O N N 300 TYR CB C N N 301 TYR CG C Y N 302 TYR CD1 C Y N 303 TYR CD2 C Y N 304 TYR CE1 C Y N 305 TYR CE2 C Y N 306 TYR CZ C Y N 307 TYR OH O N N 308 TYR OXT O N N 309 TYR H H N N 310 TYR H2 H N N 311 TYR HA H N N 312 TYR HB2 H N N 313 TYR HB3 H N N 314 TYR HD1 H N N 315 TYR HD2 H N N 316 TYR HE1 H N N 317 TYR HE2 H N N 318 TYR HH H N N 319 TYR HXT H N N 320 VAL N N N N 321 VAL CA C N S 322 VAL C C N N 323 VAL O O N N 324 VAL CB C N N 325 VAL CG1 C N N 326 VAL CG2 C N N 327 VAL OXT O N N 328 VAL H H N N 329 VAL H2 H N N 330 VAL HA H N N 331 VAL HB H N N 332 VAL HG11 H N N 333 VAL HG12 H N N 334 VAL HG13 H N N 335 VAL HG21 H N N 336 VAL HG22 H N N 337 VAL HG23 H N N 338 VAL HXT H N N 339 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 LYS N CA sing N N 145 LYS N H sing N N 146 LYS N H2 sing N N 147 LYS CA C sing N N 148 LYS CA CB sing N N 149 LYS CA HA sing N N 150 LYS C O doub N N 151 LYS C OXT sing N N 152 LYS CB CG sing N N 153 LYS CB HB2 sing N N 154 LYS CB HB3 sing N N 155 LYS CG CD sing N N 156 LYS CG HG2 sing N N 157 LYS CG HG3 sing N N 158 LYS CD CE sing N N 159 LYS CD HD2 sing N N 160 LYS CD HD3 sing N N 161 LYS CE NZ sing N N 162 LYS CE HE2 sing N N 163 LYS CE HE3 sing N N 164 LYS NZ HZ1 sing N N 165 LYS NZ HZ2 sing N N 166 LYS NZ HZ3 sing N N 167 LYS OXT HXT sing N N 168 MET N CA sing N N 169 MET N H sing N N 170 MET N H2 sing N N 171 MET CA C sing N N 172 MET CA CB sing N N 173 MET CA HA sing N N 174 MET C O doub N N 175 MET C OXT sing N N 176 MET CB CG sing N N 177 MET CB HB2 sing N N 178 MET CB HB3 sing N N 179 MET CG SD sing N N 180 MET CG HG2 sing N N 181 MET CG HG3 sing N N 182 MET SD CE sing N N 183 MET CE HE1 sing N N 184 MET CE HE2 sing N N 185 MET CE HE3 sing N N 186 MET OXT HXT sing N N 187 PHE N CA sing N N 188 PHE N H sing N N 189 PHE N H2 sing N N 190 PHE CA C sing N N 191 PHE CA CB sing N N 192 PHE CA HA sing N N 193 PHE C O doub N N 194 PHE C OXT sing N N 195 PHE CB CG sing N N 196 PHE CB HB2 sing N N 197 PHE CB HB3 sing N N 198 PHE CG CD1 doub Y N 199 PHE CG CD2 sing Y N 200 PHE CD1 CE1 sing Y N 201 PHE CD1 HD1 sing N N 202 PHE CD2 CE2 doub Y N 203 PHE CD2 HD2 sing N N 204 PHE CE1 CZ doub Y N 205 PHE CE1 HE1 sing N N 206 PHE CE2 CZ sing Y N 207 PHE CE2 HE2 sing N N 208 PHE CZ HZ sing N N 209 PHE OXT HXT sing N N 210 PRO N CA sing N N 211 PRO N CD sing N N 212 PRO N H sing N N 213 PRO CA C sing N N 214 PRO CA CB sing N N 215 PRO CA HA sing N N 216 PRO C O doub N N 217 PRO C OXT sing N N 218 PRO CB CG sing N N 219 PRO CB HB2 sing N N 220 PRO CB HB3 sing N N 221 PRO CG CD sing N N 222 PRO CG HG2 sing N N 223 PRO CG HG3 sing N N 224 PRO CD HD2 sing N N 225 PRO CD HD3 sing N N 226 PRO OXT HXT sing N N 227 SER N CA sing N N 228 SER N H sing N N 229 SER N H2 sing N N 230 SER CA C sing N N 231 SER CA CB sing N N 232 SER CA HA sing N N 233 SER C O doub N N 234 SER C OXT sing N N 235 SER CB OG sing N N 236 SER CB HB2 sing N N 237 SER CB HB3 sing N N 238 SER OG HG sing N N 239 SER OXT HXT sing N N 240 THR N CA sing N N 241 THR N H sing N N 242 THR N H2 sing N N 243 THR CA C sing N N 244 THR CA CB sing N N 245 THR CA HA sing N N 246 THR C O doub N N 247 THR C OXT sing N N 248 THR CB OG1 sing N N 249 THR CB CG2 sing N N 250 THR CB HB sing N N 251 THR OG1 HG1 sing N N 252 THR CG2 HG21 sing N N 253 THR CG2 HG22 sing N N 254 THR CG2 HG23 sing N N 255 THR OXT HXT sing N N 256 TRP N CA sing N N 257 TRP N H sing N N 258 TRP N H2 sing N N 259 TRP CA C sing N N 260 TRP CA CB sing N N 261 TRP CA HA sing N N 262 TRP C O doub N N 263 TRP C OXT sing N N 264 TRP CB CG sing N N 265 TRP CB HB2 sing N N 266 TRP CB HB3 sing N N 267 TRP CG CD1 doub Y N 268 TRP CG CD2 sing Y N 269 TRP CD1 NE1 sing Y N 270 TRP CD1 HD1 sing N N 271 TRP CD2 CE2 doub Y N 272 TRP CD2 CE3 sing Y N 273 TRP NE1 CE2 sing Y N 274 TRP NE1 HE1 sing N N 275 TRP CE2 CZ2 sing Y N 276 TRP CE3 CZ3 doub Y N 277 TRP CE3 HE3 sing N N 278 TRP CZ2 CH2 doub Y N 279 TRP CZ2 HZ2 sing N N 280 TRP CZ3 CH2 sing Y N 281 TRP CZ3 HZ3 sing N N 282 TRP CH2 HH2 sing N N 283 TRP OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2I9H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #