data_2IAK # _entry.id 2IAK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2IAK pdb_00002iak 10.2210/pdb2iak/pdb RCSB RCSB039343 ? ? WWPDB D_1000039343 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2IAK _pdbx_database_status.recvd_initial_deposition_date 2006-09-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Jefferson, J.J.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Structural analysis of the plakin domain of bullous pemphigoid antigen1 (BPAG1) suggests that plakins are members of the spectrin superfamily. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 366 _citation.page_first 244 _citation.page_last 257 _citation.year 2007 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17161423 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2006.11.036 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jefferson, J.J.' 1 ? primary 'Ciatto, C.' 2 ? primary 'Shapiro, L.' 3 ? primary 'Liem, R.K.' 4 ? # _cell.entry_id 2IAK _cell.length_a 195.800 _cell.length_b 195.800 _cell.length_c 195.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 48 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2IAK _symmetry.space_group_name_H-M 'I 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 214 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bullous pemphigoid antigen 1, isoform 5' 26559.941 1 ? V163A 'Plakin Domain, residues 226-449' ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BPA, Hemidesmosomal plaque protein, Dystonia musculorum protein, Dystonin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KLMQIRKPLLKSSLLDQNLTEEEVNMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK ISEIQMTAPLKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEESEVAYDWSERNSSVARKKS YHAELMRELEQKEESIKAVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIQE ; _entity_poly.pdbx_seq_one_letter_code_can ;KLMQIRKPLLKSSLLDQNLTEEEVNMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK ISEIQMTAPLKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEESEVAYDWSERNSSVARKKS YHAELMRELEQKEESIKAVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIQE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LEU n 1 3 MET n 1 4 GLN n 1 5 ILE n 1 6 ARG n 1 7 LYS n 1 8 PRO n 1 9 LEU n 1 10 LEU n 1 11 LYS n 1 12 SER n 1 13 SER n 1 14 LEU n 1 15 LEU n 1 16 ASP n 1 17 GLN n 1 18 ASN n 1 19 LEU n 1 20 THR n 1 21 GLU n 1 22 GLU n 1 23 GLU n 1 24 VAL n 1 25 ASN n 1 26 MET n 1 27 LYS n 1 28 PHE n 1 29 VAL n 1 30 GLN n 1 31 ASP n 1 32 LEU n 1 33 LEU n 1 34 ASN n 1 35 TRP n 1 36 VAL n 1 37 ASP n 1 38 GLU n 1 39 MET n 1 40 GLN n 1 41 VAL n 1 42 GLN n 1 43 LEU n 1 44 ASP n 1 45 ARG n 1 46 THR n 1 47 GLU n 1 48 TRP n 1 49 GLY n 1 50 SER n 1 51 ASP n 1 52 LEU n 1 53 PRO n 1 54 SER n 1 55 VAL n 1 56 GLU n 1 57 SER n 1 58 HIS n 1 59 LEU n 1 60 GLU n 1 61 ASN n 1 62 HIS n 1 63 LYS n 1 64 ASN n 1 65 VAL n 1 66 HIS n 1 67 ARG n 1 68 ALA n 1 69 ILE n 1 70 GLU n 1 71 GLU n 1 72 PHE n 1 73 GLU n 1 74 SER n 1 75 SER n 1 76 LEU n 1 77 LYS n 1 78 GLU n 1 79 ALA n 1 80 LYS n 1 81 ILE n 1 82 SER n 1 83 GLU n 1 84 ILE n 1 85 GLN n 1 86 MET n 1 87 THR n 1 88 ALA n 1 89 PRO n 1 90 LEU n 1 91 LYS n 1 92 LEU n 1 93 SER n 1 94 TYR n 1 95 THR n 1 96 ASP n 1 97 LYS n 1 98 LEU n 1 99 HIS n 1 100 ARG n 1 101 LEU n 1 102 GLU n 1 103 SER n 1 104 GLN n 1 105 TYR n 1 106 ALA n 1 107 LYS n 1 108 LEU n 1 109 LEU n 1 110 ASN n 1 111 THR n 1 112 SER n 1 113 ARG n 1 114 ASN n 1 115 GLN n 1 116 GLU n 1 117 ARG n 1 118 HIS n 1 119 LEU n 1 120 ASP n 1 121 THR n 1 122 LEU n 1 123 HIS n 1 124 ASN n 1 125 PHE n 1 126 VAL n 1 127 THR n 1 128 ARG n 1 129 ALA n 1 130 THR n 1 131 ASN n 1 132 GLU n 1 133 LEU n 1 134 ILE n 1 135 TRP n 1 136 LEU n 1 137 ASN n 1 138 GLU n 1 139 LYS n 1 140 GLU n 1 141 GLU n 1 142 SER n 1 143 GLU n 1 144 VAL n 1 145 ALA n 1 146 TYR n 1 147 ASP n 1 148 TRP n 1 149 SER n 1 150 GLU n 1 151 ARG n 1 152 ASN n 1 153 SER n 1 154 SER n 1 155 VAL n 1 156 ALA n 1 157 ARG n 1 158 LYS n 1 159 LYS n 1 160 SER n 1 161 TYR n 1 162 HIS n 1 163 ALA n 1 164 GLU n 1 165 LEU n 1 166 MET n 1 167 ARG n 1 168 GLU n 1 169 LEU n 1 170 GLU n 1 171 GLN n 1 172 LYS n 1 173 GLU n 1 174 GLU n 1 175 SER n 1 176 ILE n 1 177 LYS n 1 178 ALA n 1 179 VAL n 1 180 GLN n 1 181 GLU n 1 182 ILE n 1 183 ALA n 1 184 GLU n 1 185 GLN n 1 186 LEU n 1 187 LEU n 1 188 LEU n 1 189 GLU n 1 190 ASN n 1 191 HIS n 1 192 PRO n 1 193 ALA n 1 194 ARG n 1 195 LEU n 1 196 THR n 1 197 ILE n 1 198 GLU n 1 199 ALA n 1 200 TYR n 1 201 ARG n 1 202 ALA n 1 203 ALA n 1 204 MET n 1 205 GLN n 1 206 THR n 1 207 GLN n 1 208 TRP n 1 209 SER n 1 210 TRP n 1 211 ILE n 1 212 LEU n 1 213 GLN n 1 214 LEU n 1 215 CYS n 1 216 GLN n 1 217 CYS n 1 218 VAL n 1 219 GLU n 1 220 GLN n 1 221 HIS n 1 222 ILE n 1 223 GLN n 1 224 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'Dst, Bpag1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET SUMO' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BPAEA_MOUSE _struct_ref.pdbx_db_accession Q91ZU8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KLMQIRKPLLKSSLLDQNLTEEEVNMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK ISEIQMTAPLKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEESEVAYDWSERNSSVARKKS YHVELMRELEQKEESIKAVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIQE ; _struct_ref.pdbx_align_begin 226 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2IAK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 224 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q91ZU8 _struct_ref_seq.db_align_beg 226 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 449 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 224 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2IAK _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 163 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q91ZU8 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 388 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 163 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2IAK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 5.89 _exptl_crystal.density_percent_sol 79.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 273 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.2 _exptl_crystal_grow.pdbx_details '1.6M ammonium sulphate, 50mM CAPSO, pH 9.2, VAPOR DIFFUSION, HANGING DROP, temperature 273K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2005-10-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9791 # _reflns.entry_id 2IAK _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.d_resolution_high 3.0 _reflns.d_resolution_low 20 _reflns.number_all 24211 _reflns.number_obs 24299 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3 _reflns_shell.d_res_low 3.18 _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2IAK _refine.ls_number_reflns_obs 12428 _refine.ls_number_reflns_all 24211 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 3.00 _refine.ls_percent_reflns_obs 99.68 _refine.ls_R_factor_obs 0.22819 _refine.ls_R_factor_all 0.226 _refine.ls_R_factor_R_work 0.2263 _refine.ls_R_factor_R_free 0.26655 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 647 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.918 _refine.correlation_coeff_Fo_to_Fc_free 0.885 _refine.B_iso_mean 41.221 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.313 _refine.pdbx_overall_ESU_R_Free 0.290 _refine.overall_SU_ML 0.211 _refine.overall_SU_B 24.914 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1550 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 1571 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.021 ? 1584 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.890 1.948 ? 2145 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 8.239 5.000 ? 196 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 40.889 26.111 ? 72 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 23.238 15.000 ? 282 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 16.057 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.137 0.200 ? 250 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 1158 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.298 0.200 ? 823 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.324 0.200 ? 1114 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.156 0.200 ? 59 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.192 0.200 ? 26 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.166 0.200 ? 2 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 3.00 _refine_ls_shell.d_res_low ? _refine_ls_shell.number_reflns_R_work 892 _refine_ls_shell.R_factor_R_work ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2IAK _struct.title 'Crystal Structure of a protease resistant fragment of the plakin domain of Bullous Pemphigoid Antigen1 (BPAG1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2IAK _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'Triple helical bundle, spectrin repeat, CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 10 ? LEU A 15 ? LEU A 10 LEU A 15 5 ? 6 HELX_P HELX_P2 2 THR A 20 ? ARG A 45 ? THR A 20 ARG A 45 1 ? 26 HELX_P HELX_P3 3 ASP A 51 ? PHE A 72 ? ASP A 51 PHE A 72 1 ? 22 HELX_P HELX_P4 4 PHE A 72 ? GLU A 83 ? PHE A 72 GLU A 83 1 ? 12 HELX_P HELX_P5 5 ILE A 84 ? MET A 86 ? ILE A 84 MET A 86 5 ? 3 HELX_P HELX_P6 6 LEU A 90 ? LEU A 108 ? LEU A 90 LEU A 108 1 ? 19 HELX_P HELX_P7 7 ASN A 110 ? VAL A 144 ? ASN A 110 VAL A 144 1 ? 35 HELX_P HELX_P8 8 GLU A 164 ? GLU A 189 ? GLU A 164 GLU A 189 1 ? 26 HELX_P HELX_P9 9 ALA A 193 ? GLN A 216 ? ALA A 193 GLN A 216 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 88 A . ? ALA 88 A PRO 89 A ? PRO 89 A 1 1.94 2 TYR 161 A . ? TYR 161 A HIS 162 A ? HIS 162 A 1 -19.97 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 225 ? 4 'BINDING SITE FOR RESIDUE SO4 A 225' AC2 Software A SO4 226 ? 2 'BINDING SITE FOR RESIDUE SO4 A 226' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ALA A 88 ? ALA A 88 . ? 30_555 ? 2 AC1 4 ILE A 176 ? ILE A 176 . ? 1_555 ? 3 AC1 4 GLN A 205 ? GLN A 205 . ? 1_555 ? 4 AC1 4 TRP A 208 ? TRP A 208 . ? 1_555 ? 5 AC2 2 LYS A 97 ? LYS A 97 . ? 1_555 ? 6 AC2 2 LYS A 97 ? LYS A 97 . ? 37_545 ? # _database_PDB_matrix.entry_id 2IAK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2IAK _atom_sites.fract_transf_matrix[1][1] 0.005107 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005107 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005107 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 MET 3 3 ? ? ? A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 LYS 63 63 63 LYS ALA A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 GLU 141 141 141 GLU ALA A . n A 1 142 SER 142 142 142 SER ALA A . n A 1 143 GLU 143 143 143 GLU ALA A . n A 1 144 VAL 144 144 144 VAL ALA A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 TYR 146 146 ? ? ? A . n A 1 147 ASP 147 147 ? ? ? A . n A 1 148 TRP 148 148 ? ? ? A . n A 1 149 SER 149 149 ? ? ? A . n A 1 150 GLU 150 150 ? ? ? A . n A 1 151 ARG 151 151 ? ? ? A . n A 1 152 ASN 152 152 ? ? ? A . n A 1 153 SER 153 153 ? ? ? A . n A 1 154 SER 154 154 ? ? ? A . n A 1 155 VAL 155 155 ? ? ? A . n A 1 156 ALA 156 156 ? ? ? A . n A 1 157 ARG 157 157 ? ? ? A . n A 1 158 LYS 158 158 ? ? ? A . n A 1 159 LYS 159 159 ? ? ? A . n A 1 160 SER 160 160 ? ? ? A . n A 1 161 TYR 161 161 161 TYR ALA A . n A 1 162 HIS 162 162 162 HIS ALA A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 GLU 164 164 164 GLU ALA A . n A 1 165 LEU 165 165 165 LEU ALA A . n A 1 166 MET 166 166 166 MET ALA A . n A 1 167 ARG 167 167 167 ARG ALA A . n A 1 168 GLU 168 168 168 GLU ALA A . n A 1 169 LEU 169 169 169 LEU ALA A . n A 1 170 GLU 170 170 170 GLU ALA A . n A 1 171 GLN 171 171 171 GLN ALA A . n A 1 172 LYS 172 172 172 LYS ALA A . n A 1 173 GLU 173 173 173 GLU ALA A . n A 1 174 GLU 174 174 174 GLU ALA A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 GLU 181 181 181 GLU ALA A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 GLN 185 185 185 GLN GLN A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 HIS 191 191 191 HIS HIS A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 TRP 208 208 208 TRP TRP A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 TRP 210 210 210 TRP TRP A . n A 1 211 ILE 211 211 211 ILE ILE A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 GLN 213 213 213 GLN GLN A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 CYS 215 215 215 CYS CYS A . n A 1 216 GLN 216 216 216 GLN GLN A . n A 1 217 CYS 217 217 ? ? ? A . n A 1 218 VAL 218 218 ? ? ? A . n A 1 219 GLU 219 219 ? ? ? A . n A 1 220 GLN 220 220 ? ? ? A . n A 1 221 HIS 221 221 ? ? ? A . n A 1 222 ILE 222 222 ? ? ? A . n A 1 223 GLN 223 223 ? ? ? A . n A 1 224 GLU 224 224 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 225 4 SO4 SO4 A . C 2 SO4 1 226 1 SO4 SO4 A . D 3 HOH 1 227 1 HOH HOH A . D 3 HOH 2 228 57 HOH HOH A . D 3 HOH 3 229 58 HOH HOH A . D 3 HOH 4 230 59 HOH HOH A . D 3 HOH 5 231 67 HOH HOH A . D 3 HOH 6 232 74 HOH HOH A . D 3 HOH 7 233 82 HOH HOH A . D 3 HOH 8 234 83 HOH HOH A . D 3 HOH 9 235 84 HOH HOH A . D 3 HOH 10 236 89 HOH HOH A . D 3 HOH 11 237 1 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA hexameric 6 3 software_defined_assembly PQS trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2,3,4,5,6 A,B,C,D 3 1,2,3 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 11020 ? 2 MORE -224 ? 2 'SSA (A^2)' 60370 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 -z+1/2,-x,y+1/2 0.0000000000 0.0000000000 -1.0000000000 97.9000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 97.9000000000 3 'crystal symmetry operation' 10_545 -y,z-1/2,-x+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -97.9000000000 -1.0000000000 0.0000000000 0.0000000000 97.9000000000 4 'crystal symmetry operation' 37_545 y+1/4,x-1/4,-z+3/4 0.0000000000 1.0000000000 0.0000000000 48.9500000000 1.0000000000 0.0000000000 0.0000000000 -48.9500000000 0.0000000000 0.0000000000 -1.0000000000 146.8500000000 5 'crystal symmetry operation' 43_555 -x+1/4,-z+1/4,-y+1/4 -1.0000000000 0.0000000000 0.0000000000 48.9500000000 0.0000000000 0.0000000000 -1.0000000000 48.9500000000 0.0000000000 -1.0000000000 0.0000000000 48.9500000000 6 'crystal symmetry operation' 46_445 z-1/4,-y-1/4,x+1/4 0.0000000000 0.0000000000 1.0000000000 -48.9500000000 0.0000000000 -1.0000000000 0.0000000000 -48.9500000000 1.0000000000 0.0000000000 0.0000000000 48.9500000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-28 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' 5 3 'Structure model' 'Version format compliance' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_ref_seq_dif 3 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 38.8591 -9.4948 64.4534 -0.2467 0.2028 -0.0094 -0.0551 -0.0391 0.1033 5.4082 32.7745 7.4083 7.2420 -0.9641 -10.0322 0.0753 0.5212 -0.5965 -0.4259 0.2590 1.7630 0.4840 -0.1919 -1.2829 'X-RAY DIFFRACTION' 2 ? refined 49.3755 -17.9955 69.7615 -0.1657 -0.0243 0.0887 -0.0715 -0.1450 0.1735 0.0059 10.4797 2.5833 0.1799 -0.1058 -5.0784 -0.0208 0.1255 -0.1047 -0.0455 0.0242 -0.3502 0.7490 -0.1741 -0.1756 'X-RAY DIFFRACTION' 3 ? refined 52.6721 -50.8992 82.9768 0.0427 -0.0567 -0.1562 0.0505 -0.1111 0.0274 5.8861 3.4082 5.7803 -1.6430 1.2991 -1.5338 -0.0598 -0.0239 0.0837 0.3023 -0.3417 -0.4281 -0.3417 0.7949 0.0897 'X-RAY DIFFRACTION' 4 ? refined 51.9940 -64.4459 93.1062 0.4347 -0.0370 0.0058 0.0565 -0.2308 0.0491 12.5880 22.1338 54.0851 -2.6472 -17.4257 -13.0056 -0.9683 0.4972 0.4711 -0.6559 -1.5323 -0.7124 1.2240 2.7747 -1.3900 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 4 A 21 ? . . . . ? 'X-RAY DIFFRACTION' 2 2 A 22 A 112 ? . . . . ? 'X-RAY DIFFRACTION' 3 3 A 113 A 206 ? . . . . ? 'X-RAY DIFFRACTION' 4 4 A 207 A 213 ? . . . . ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0016 ? 1 CBASS 'data collection' . ? 2 XDS 'data reduction' . ? 3 XDS 'data scaling' . ? 4 SHELXS phasing . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 15 ? ? O A GLN 17 ? ? 1.79 2 1 CB A ASN 18 ? ? O A HOH 237 ? ? 1.98 3 1 O A GLU 141 ? ? O A VAL 144 ? ? 2.12 4 1 O A LEU 43 ? ? OG1 A THR 46 ? ? 2.12 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLN 216 ? ? OE1 A GLN 216 ? ? 1.413 1.235 0.178 0.022 N 2 1 CD A GLN 216 ? ? NE2 A GLN 216 ? ? 1.581 1.324 0.257 0.025 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 16 ? ? CA A ASP 16 ? ? C A ASP 16 ? ? 95.79 110.40 -14.61 2.00 N 2 1 N A GLN 17 ? ? CA A GLN 17 ? ? CB A GLN 17 ? ? 96.41 110.60 -14.19 1.80 N 3 1 CA A LEU 108 ? ? CB A LEU 108 ? ? CG A LEU 108 ? ? 131.83 115.30 16.53 2.30 N 4 1 CB A LEU 109 ? ? CA A LEU 109 ? ? C A LEU 109 ? ? 92.40 110.20 -17.80 1.90 N 5 1 N A ASN 110 ? ? CA A ASN 110 ? ? C A ASN 110 ? ? 92.90 111.00 -18.10 2.70 N 6 1 CB A GLU 141 ? ? CA A GLU 141 ? ? C A GLU 141 ? ? 91.19 110.40 -19.21 2.00 N 7 1 CB A ALA 163 ? ? CA A ALA 163 ? ? C A ALA 163 ? ? 90.52 110.10 -19.58 1.50 N 8 1 N A ALA 163 ? ? CA A ALA 163 ? ? C A ALA 163 ? ? 147.39 111.00 36.39 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 13 ? ? -59.13 -7.42 2 1 LEU A 109 ? ? 82.19 -11.49 3 1 SER A 142 ? ? -142.84 -60.08 4 1 HIS A 162 ? ? -134.67 -68.07 5 1 ALA A 163 ? ? 76.22 -58.65 6 1 LYS A 177 ? ? -68.91 15.72 7 1 ALA A 178 ? ? -137.29 -56.64 8 1 ALA A 193 ? ? -95.17 32.21 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASP A 16 ? ? GLN A 17 ? ? 126.11 2 1 GLU A 141 ? ? SER A 142 ? ? -107.88 3 1 SER A 142 ? ? GLU A 143 ? ? 121.25 4 1 HIS A 162 ? ? ALA A 163 ? ? 33.74 5 1 LYS A 177 ? ? ALA A 178 ? ? -141.38 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 26 ? CE ? A MET 26 CE 2 1 Y 1 A LYS 27 ? O ? A LYS 27 O 3 1 Y 1 A GLN 42 ? OE1 ? A GLN 42 OE1 4 1 Y 1 A GLN 42 ? NE2 ? A GLN 42 NE2 5 1 Y 1 A ARG 45 ? CD ? A ARG 45 CD 6 1 Y 1 A ARG 45 ? NE ? A ARG 45 NE 7 1 Y 1 A ARG 45 ? CZ ? A ARG 45 CZ 8 1 Y 1 A ARG 45 ? NH1 ? A ARG 45 NH1 9 1 Y 1 A ARG 45 ? NH2 ? A ARG 45 NH2 10 1 Y 1 A GLU 60 ? OE1 ? A GLU 60 OE1 11 1 Y 1 A GLU 60 ? OE2 ? A GLU 60 OE2 12 1 Y 1 A ASN 61 ? ND2 ? A ASN 61 ND2 13 1 Y 1 A LYS 63 ? CG ? A LYS 63 CG 14 1 Y 1 A LYS 63 ? CD ? A LYS 63 CD 15 1 Y 1 A LYS 63 ? CE ? A LYS 63 CE 16 1 Y 1 A LYS 63 ? NZ ? A LYS 63 NZ 17 1 Y 1 A ARG 67 ? NH1 ? A ARG 67 NH1 18 1 Y 1 A ARG 67 ? NH2 ? A ARG 67 NH2 19 1 Y 1 A GLN 85 ? OE1 ? A GLN 85 OE1 20 1 Y 1 A ARG 117 ? NH1 ? A ARG 117 NH1 21 1 Y 1 A ARG 117 ? NH2 ? A ARG 117 NH2 22 1 Y 1 A GLU 141 ? CG ? A GLU 141 CG 23 1 Y 1 A GLU 141 ? CD ? A GLU 141 CD 24 1 Y 1 A GLU 141 ? OE1 ? A GLU 141 OE1 25 1 Y 1 A GLU 141 ? OE2 ? A GLU 141 OE2 26 1 Y 1 A SER 142 ? OG ? A SER 142 OG 27 1 Y 1 A GLU 143 ? CG ? A GLU 143 CG 28 1 Y 1 A GLU 143 ? CD ? A GLU 143 CD 29 1 Y 1 A GLU 143 ? OE1 ? A GLU 143 OE1 30 1 Y 1 A GLU 143 ? OE2 ? A GLU 143 OE2 31 1 Y 1 A VAL 144 ? CG1 ? A VAL 144 CG1 32 1 Y 1 A VAL 144 ? CG2 ? A VAL 144 CG2 33 1 Y 1 A TYR 161 ? CG ? A TYR 161 CG 34 1 Y 1 A TYR 161 ? CD1 ? A TYR 161 CD1 35 1 Y 1 A TYR 161 ? CD2 ? A TYR 161 CD2 36 1 Y 1 A TYR 161 ? CE1 ? A TYR 161 CE1 37 1 Y 1 A TYR 161 ? CE2 ? A TYR 161 CE2 38 1 Y 1 A TYR 161 ? CZ ? A TYR 161 CZ 39 1 Y 1 A TYR 161 ? OH ? A TYR 161 OH 40 1 Y 1 A HIS 162 ? CG ? A HIS 162 CG 41 1 Y 1 A HIS 162 ? ND1 ? A HIS 162 ND1 42 1 Y 1 A HIS 162 ? CD2 ? A HIS 162 CD2 43 1 Y 1 A HIS 162 ? CE1 ? A HIS 162 CE1 44 1 Y 1 A HIS 162 ? NE2 ? A HIS 162 NE2 45 1 Y 1 A GLU 164 ? CG ? A GLU 164 CG 46 1 Y 1 A GLU 164 ? CD ? A GLU 164 CD 47 1 Y 1 A GLU 164 ? OE1 ? A GLU 164 OE1 48 1 Y 1 A GLU 164 ? OE2 ? A GLU 164 OE2 49 1 Y 1 A LEU 165 ? CG ? A LEU 165 CG 50 1 Y 1 A LEU 165 ? CD1 ? A LEU 165 CD1 51 1 Y 1 A LEU 165 ? CD2 ? A LEU 165 CD2 52 1 Y 1 A MET 166 ? CG ? A MET 166 CG 53 1 Y 1 A MET 166 ? SD ? A MET 166 SD 54 1 Y 1 A MET 166 ? CE ? A MET 166 CE 55 1 Y 1 A ARG 167 ? CG ? A ARG 167 CG 56 1 Y 1 A ARG 167 ? CD ? A ARG 167 CD 57 1 Y 1 A ARG 167 ? NE ? A ARG 167 NE 58 1 Y 1 A ARG 167 ? CZ ? A ARG 167 CZ 59 1 Y 1 A ARG 167 ? NH1 ? A ARG 167 NH1 60 1 Y 1 A ARG 167 ? NH2 ? A ARG 167 NH2 61 1 Y 1 A GLU 168 ? CG ? A GLU 168 CG 62 1 Y 1 A GLU 168 ? CD ? A GLU 168 CD 63 1 Y 1 A GLU 168 ? OE1 ? A GLU 168 OE1 64 1 Y 1 A GLU 168 ? OE2 ? A GLU 168 OE2 65 1 Y 1 A LEU 169 ? CG ? A LEU 169 CG 66 1 Y 1 A LEU 169 ? CD1 ? A LEU 169 CD1 67 1 Y 1 A LEU 169 ? CD2 ? A LEU 169 CD2 68 1 Y 1 A GLU 170 ? CG ? A GLU 170 CG 69 1 Y 1 A GLU 170 ? CD ? A GLU 170 CD 70 1 Y 1 A GLU 170 ? OE1 ? A GLU 170 OE1 71 1 Y 1 A GLU 170 ? OE2 ? A GLU 170 OE2 72 1 Y 1 A GLN 171 ? CG ? A GLN 171 CG 73 1 Y 1 A GLN 171 ? CD ? A GLN 171 CD 74 1 Y 1 A GLN 171 ? OE1 ? A GLN 171 OE1 75 1 Y 1 A GLN 171 ? NE2 ? A GLN 171 NE2 76 1 Y 1 A LYS 172 ? CG ? A LYS 172 CG 77 1 Y 1 A LYS 172 ? CD ? A LYS 172 CD 78 1 Y 1 A LYS 172 ? CE ? A LYS 172 CE 79 1 Y 1 A LYS 172 ? NZ ? A LYS 172 NZ 80 1 Y 1 A GLU 173 ? CG ? A GLU 173 CG 81 1 Y 1 A GLU 173 ? CD ? A GLU 173 CD 82 1 Y 1 A GLU 173 ? OE1 ? A GLU 173 OE1 83 1 Y 1 A GLU 173 ? OE2 ? A GLU 173 OE2 84 1 Y 1 A GLU 174 ? CG ? A GLU 174 CG 85 1 Y 1 A GLU 174 ? CD ? A GLU 174 CD 86 1 Y 1 A GLU 174 ? OE1 ? A GLU 174 OE1 87 1 Y 1 A GLU 174 ? OE2 ? A GLU 174 OE2 88 1 Y 1 A LYS 177 ? NZ ? A LYS 177 NZ 89 1 Y 1 A GLU 181 ? CG ? A GLU 181 CG 90 1 Y 1 A GLU 181 ? CD ? A GLU 181 CD 91 1 Y 1 A GLU 181 ? OE1 ? A GLU 181 OE1 92 1 Y 1 A GLU 181 ? OE2 ? A GLU 181 OE2 93 1 Y 1 A ARG 194 ? NE ? A ARG 194 NE 94 1 Y 1 A GLN 216 ? O ? A GLN 216 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 1 ? A LYS 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A MET 3 ? A MET 3 4 1 Y 1 A TYR 146 ? A TYR 146 5 1 Y 1 A ASP 147 ? A ASP 147 6 1 Y 1 A TRP 148 ? A TRP 148 7 1 Y 1 A SER 149 ? A SER 149 8 1 Y 1 A GLU 150 ? A GLU 150 9 1 Y 1 A ARG 151 ? A ARG 151 10 1 Y 1 A ASN 152 ? A ASN 152 11 1 Y 1 A SER 153 ? A SER 153 12 1 Y 1 A SER 154 ? A SER 154 13 1 Y 1 A VAL 155 ? A VAL 155 14 1 Y 1 A ALA 156 ? A ALA 156 15 1 Y 1 A ARG 157 ? A ARG 157 16 1 Y 1 A LYS 158 ? A LYS 158 17 1 Y 1 A LYS 159 ? A LYS 159 18 1 Y 1 A SER 160 ? A SER 160 19 1 Y 1 A CYS 217 ? A CYS 217 20 1 Y 1 A VAL 218 ? A VAL 218 21 1 Y 1 A GLU 219 ? A GLU 219 22 1 Y 1 A GLN 220 ? A GLN 220 23 1 Y 1 A HIS 221 ? A HIS 221 24 1 Y 1 A ILE 222 ? A ILE 222 25 1 Y 1 A GLN 223 ? A GLN 223 26 1 Y 1 A GLU 224 ? A GLU 224 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #