data_2ID6 # _entry.id 2ID6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2ID6 RCSB RCSB039435 WWPDB D_1000039435 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1Z77 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ID6 _pdbx_database_status.recvd_initial_deposition_date 2006-09-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Koclega, K.D.' 1 'Chruszcz, M.' 2 'Minor, W.' 3 # _citation.id primary _citation.title 'Crystal structure of transcriptional regulator (tm1030) at 1.75A resolution' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Koclega, K.D.' 1 primary 'Chruszcz, M.' 2 primary 'Minor, W.' 3 # _cell.entry_id 2ID6 _cell.length_a 55.765 _cell.length_b 66.012 _cell.length_c 55.623 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2ID6 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 18 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRANSCRIPTIONAL REGULATOR, TetR FAMILY' 24409.078 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 water nat water 18.015 151 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GH(MSE)LSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAY(MSE)SVTEKLQKEFENFL (MSE)KNRNRDIFDF(MSE)ERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLA EDVTEEIALKFL(MSE)WFFSGFEEVYLRTYQGKPELLKRD(MSE)NTLVEEVKV(MSE)LRILKKG(MSE)TK ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDI FDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFF SGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MSE n 1 4 LEU n 1 5 SER n 1 6 LYS n 1 7 ARG n 1 8 ASP n 1 9 ALA n 1 10 ILE n 1 11 LEU n 1 12 LYS n 1 13 ALA n 1 14 ALA n 1 15 VAL n 1 16 GLU n 1 17 VAL n 1 18 PHE n 1 19 GLY n 1 20 LYS n 1 21 LYS n 1 22 GLY n 1 23 TYR n 1 24 ASP n 1 25 ARG n 1 26 ALA n 1 27 THR n 1 28 THR n 1 29 ASP n 1 30 GLU n 1 31 ILE n 1 32 ALA n 1 33 GLU n 1 34 LYS n 1 35 ALA n 1 36 GLY n 1 37 VAL n 1 38 ALA n 1 39 LYS n 1 40 GLY n 1 41 LEU n 1 42 ILE n 1 43 PHE n 1 44 HIS n 1 45 TYR n 1 46 PHE n 1 47 LYS n 1 48 ASN n 1 49 LYS n 1 50 GLU n 1 51 GLU n 1 52 LEU n 1 53 TYR n 1 54 TYR n 1 55 GLN n 1 56 ALA n 1 57 TYR n 1 58 MSE n 1 59 SER n 1 60 VAL n 1 61 THR n 1 62 GLU n 1 63 LYS n 1 64 LEU n 1 65 GLN n 1 66 LYS n 1 67 GLU n 1 68 PHE n 1 69 GLU n 1 70 ASN n 1 71 PHE n 1 72 LEU n 1 73 MSE n 1 74 LYS n 1 75 ASN n 1 76 ARG n 1 77 ASN n 1 78 ARG n 1 79 ASP n 1 80 ILE n 1 81 PHE n 1 82 ASP n 1 83 PHE n 1 84 MSE n 1 85 GLU n 1 86 ARG n 1 87 TRP n 1 88 ILE n 1 89 GLU n 1 90 LYS n 1 91 LYS n 1 92 LEU n 1 93 GLU n 1 94 TYR n 1 95 SER n 1 96 ALA n 1 97 SER n 1 98 HIS n 1 99 PRO n 1 100 GLU n 1 101 GLU n 1 102 ALA n 1 103 ASP n 1 104 PHE n 1 105 LEU n 1 106 ILE n 1 107 THR n 1 108 LEU n 1 109 VAL n 1 110 SER n 1 111 VAL n 1 112 ASP n 1 113 GLU n 1 114 GLY n 1 115 LEU n 1 116 ARG n 1 117 LYS n 1 118 ARG n 1 119 ILE n 1 120 LEU n 1 121 LEU n 1 122 ASP n 1 123 LEU n 1 124 GLU n 1 125 LYS n 1 126 SER n 1 127 GLN n 1 128 ARG n 1 129 VAL n 1 130 PHE n 1 131 PHE n 1 132 ASP n 1 133 PHE n 1 134 VAL n 1 135 ARG n 1 136 GLU n 1 137 LYS n 1 138 LEU n 1 139 LYS n 1 140 ASP n 1 141 LEU n 1 142 ASP n 1 143 LEU n 1 144 ALA n 1 145 GLU n 1 146 ASP n 1 147 VAL n 1 148 THR n 1 149 GLU n 1 150 GLU n 1 151 ILE n 1 152 ALA n 1 153 LEU n 1 154 LYS n 1 155 PHE n 1 156 LEU n 1 157 MSE n 1 158 TRP n 1 159 PHE n 1 160 PHE n 1 161 SER n 1 162 GLY n 1 163 PHE n 1 164 GLU n 1 165 GLU n 1 166 VAL n 1 167 TYR n 1 168 LEU n 1 169 ARG n 1 170 THR n 1 171 TYR n 1 172 GLN n 1 173 GLY n 1 174 LYS n 1 175 PRO n 1 176 GLU n 1 177 LEU n 1 178 LEU n 1 179 LYS n 1 180 ARG n 1 181 ASP n 1 182 MSE n 1 183 ASN n 1 184 THR n 1 185 LEU n 1 186 VAL n 1 187 GLU n 1 188 GLU n 1 189 VAL n 1 190 LYS n 1 191 VAL n 1 192 MSE n 1 193 LEU n 1 194 ARG n 1 195 ILE n 1 196 LEU n 1 197 LYS n 1 198 LYS n 1 199 GLY n 1 200 MSE n 1 201 THR n 1 202 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermotoga _entity_src_gen.pdbx_gene_src_gene TM1030 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2336 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9X0C0_THEMA _struct_ref.pdbx_db_accession Q9X0C0 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFD FMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSG FEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ID6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 202 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9X0C0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 200 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ID6 GLY A 1 ? UNP Q9X0C0 ? ? 'EXPRESSION TAG' -1 1 1 2ID6 HIS A 2 ? UNP Q9X0C0 ? ? 'EXPRESSION TAG' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2ID6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_percent_sol 41.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details '3%w/v Dextrose, 30%w/v PEG 2K MME, 0.1 M KSCN, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2006-06-11 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 channel' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.27819 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.27819 # _reflns.entry_id 2ID6 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.d_resolution_high 1.746 _reflns.d_resolution_low 33.83 _reflns.number_all 21489 _reflns.number_obs 21339 _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.062 _reflns.pdbx_Rsym_value 0.061 _reflns.pdbx_netI_over_sigmaI 45.9 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.746 _reflns_shell.d_res_low 1.81 _reflns_shell.percent_possible_all 98.0 _reflns_shell.Rmerge_I_obs 0.397 _reflns_shell.pdbx_Rsym_value 0.365 _reflns_shell.meanI_over_sigI_obs 2.9 _reflns_shell.pdbx_redundancy 5.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2043 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2ID6 _refine.ls_number_reflns_obs 20076 _refine.ls_number_reflns_all 20076 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.83 _refine.ls_d_res_high 1.746 _refine.ls_percent_reflns_obs 98.60 _refine.ls_R_factor_obs 0.21136 _refine.ls_R_factor_all 0.21136 _refine.ls_R_factor_R_work 0.20916 _refine.ls_R_factor_R_free 0.25102 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 1091 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.951 _refine.correlation_coeff_Fo_to_Fc_free 0.926 _refine.B_iso_mean 32.019 _refine.aniso_B[1][1] -0.64 _refine.aniso_B[2][2] -0.17 _refine.aniso_B[3][3] 0.81 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 1Z77 _refine.pdbx_method_to_determine_struct 'isomorphous replacement' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.140 _refine.pdbx_overall_ESU_R_Free 0.135 _refine.overall_SU_ML 0.092 _refine.overall_SU_B 5.756 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1657 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 151 _refine_hist.number_atoms_total 1812 _refine_hist.d_res_high 1.746 _refine_hist.d_res_low 33.83 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.022 0.022 ? 1693 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.493 1.968 ? 2273 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.425 5.000 ? 205 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.256 23.580 ? 81 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.814 15.000 ? 322 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 21.717 15.000 ? 12 'X-RAY DIFFRACTION' ? r_chiral_restr 0.098 0.200 ? 248 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 1259 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.210 0.200 ? 823 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.311 0.200 ? 1205 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.140 0.200 ? 119 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.280 0.200 ? 58 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.160 0.200 ? 14 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.313 1.500 ? 1050 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.551 2.000 ? 1622 'X-RAY DIFFRACTION' ? r_scbond_it 3.355 3.000 ? 740 'X-RAY DIFFRACTION' ? r_scangle_it 4.379 4.500 ? 650 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.746 _refine_ls_shell.d_res_low 1.791 _refine_ls_shell.number_reflns_R_work 1310 _refine_ls_shell.R_factor_R_work 0.237 _refine_ls_shell.percent_reflns_obs 90.07 _refine_ls_shell.R_factor_R_free 0.361 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 87 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2ID6 _struct.title 'Crystal structure of transcriptional regulator (tm1030) at 1.75A resolution' _struct.pdbx_descriptor 'TRANSCRIPTIONAL REGULATOR, TetR FAMILY' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ID6 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'transcriptional regulator; TetR Family, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ;The biological assembly is a dimer generated from the monomer in the asymmetric unit by the operations: -x, -y+1, z REMARK 6 transformation matrix: REMARK 6 -1.0 0.0 0.0 | 0.0 REMARK 6 0.0 -1.0 0.0 | 1.0 REMARK 6 0.0 0.0 1.0 | 0.0 ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 5 ? ALA A 26 ? SER A 3 ALA A 24 1 ? 22 HELX_P HELX_P2 2 THR A 27 ? GLY A 36 ? THR A 25 GLY A 34 1 ? 10 HELX_P HELX_P3 3 LYS A 39 ? LYS A 47 ? LYS A 37 LYS A 45 1 ? 9 HELX_P HELX_P4 4 ASN A 48 ? ARG A 76 ? ASN A 46 ARG A 74 1 ? 29 HELX_P HELX_P5 5 ASP A 79 ? HIS A 98 ? ASP A 77 HIS A 96 1 ? 20 HELX_P HELX_P6 6 HIS A 98 ? ILE A 106 ? HIS A 96 ILE A 104 1 ? 9 HELX_P HELX_P7 7 THR A 107 ? VAL A 111 ? THR A 105 VAL A 109 5 ? 5 HELX_P HELX_P8 8 ASP A 112 ? LYS A 139 ? ASP A 110 LYS A 137 1 ? 28 HELX_P HELX_P9 9 THR A 148 ? TYR A 171 ? THR A 146 TYR A 169 1 ? 24 HELX_P HELX_P10 10 LYS A 174 ? THR A 201 ? LYS A 172 THR A 199 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A HIS 2 C ? ? ? 1_555 A MSE 3 N ? ? A HIS 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.336 ? covale2 covale ? ? A MSE 3 C ? ? ? 1_555 A LEU 4 N ? ? A MSE 1 A LEU 2 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale ? ? A TYR 57 C ? ? ? 1_555 A MSE 58 N ? ? A TYR 55 A MSE 56 1_555 ? ? ? ? ? ? ? 1.320 ? covale4 covale ? ? A MSE 58 C ? ? ? 1_555 A SER 59 N ? ? A MSE 56 A SER 57 1_555 ? ? ? ? ? ? ? 1.327 ? covale5 covale ? ? A LEU 72 C ? ? ? 1_555 A MSE 73 N ? ? A LEU 70 A MSE 71 1_555 ? ? ? ? ? ? ? 1.338 ? covale6 covale ? ? A MSE 73 C ? ? ? 1_555 A LYS 74 N ? ? A MSE 71 A LYS 72 1_555 ? ? ? ? ? ? ? 1.330 ? covale7 covale ? ? A PHE 83 C ? ? ? 1_555 A MSE 84 N ? ? A PHE 81 A MSE 82 1_555 ? ? ? ? ? ? ? 1.323 ? covale8 covale ? ? A MSE 84 C ? ? ? 1_555 A GLU 85 N ? ? A MSE 82 A GLU 83 1_555 ? ? ? ? ? ? ? 1.332 ? covale9 covale ? ? A LEU 156 C ? ? ? 1_555 A MSE 157 N ? ? A LEU 154 A MSE 155 1_555 ? ? ? ? ? ? ? 1.330 ? covale10 covale ? ? A MSE 157 C ? ? ? 1_555 A TRP 158 N ? ? A MSE 155 A TRP 156 1_555 ? ? ? ? ? ? ? 1.320 ? covale11 covale ? ? A ASP 181 C ? ? ? 1_555 A MSE 182 N ? ? A ASP 179 A MSE 180 1_555 ? ? ? ? ? ? ? 1.346 ? covale12 covale ? ? A MSE 182 C ? ? ? 1_555 A ASN 183 N ? ? A MSE 180 A ASN 181 1_555 ? ? ? ? ? ? ? 1.328 ? covale13 covale ? ? A VAL 191 C ? ? ? 1_555 A MSE 192 N ? ? A VAL 189 A MSE 190 1_555 ? ? ? ? ? ? ? 1.326 ? covale14 covale ? ? A MSE 192 C ? ? ? 1_555 A LEU 193 N ? ? A MSE 190 A LEU 191 1_555 ? ? ? ? ? ? ? 1.330 ? covale15 covale ? ? A GLY 199 C ? ? ? 1_555 A MSE 200 N ? ? A GLY 197 A MSE 198 1_555 ? ? ? ? ? ? ? 1.327 ? covale16 covale ? ? A MSE 200 C ? ? ? 1_555 A THR 201 N ? ? A MSE 198 A THR 199 1_555 ? ? ? ? ? ? ? 1.322 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE EDO A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 SER A 95 ? SER A 93 . ? 1_555 ? 2 AC1 7 ALA A 102 ? ALA A 100 . ? 1_555 ? 3 AC1 7 TYR A 171 ? TYR A 169 . ? 1_555 ? 4 AC1 7 LYS A 174 ? LYS A 172 . ? 1_555 ? 5 AC1 7 PRO A 175 ? PRO A 173 . ? 1_555 ? 6 AC1 7 HOH C . ? HOH A 1023 . ? 1_555 ? 7 AC1 7 HOH C . ? HOH A 1070 . ? 1_555 ? # _atom_sites.entry_id 2ID6 _atom_sites.fract_transf_matrix[1][1] 0.017932 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015149 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017978 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 HIS 2 0 0 HIS HIS A . n A 1 3 MSE 3 1 1 MSE MSE A . n A 1 4 LEU 4 2 2 LEU LEU A . n A 1 5 SER 5 3 3 SER SER A . n A 1 6 LYS 6 4 4 LYS LYS A . n A 1 7 ARG 7 5 5 ARG ARG A . n A 1 8 ASP 8 6 6 ASP ASP A . n A 1 9 ALA 9 7 7 ALA ALA A . n A 1 10 ILE 10 8 8 ILE ILE A . n A 1 11 LEU 11 9 9 LEU LEU A . n A 1 12 LYS 12 10 10 LYS LYS A . n A 1 13 ALA 13 11 11 ALA ALA A . n A 1 14 ALA 14 12 12 ALA ALA A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 GLU 16 14 14 GLU GLU A . n A 1 17 VAL 17 15 15 VAL VAL A . n A 1 18 PHE 18 16 16 PHE PHE A . n A 1 19 GLY 19 17 17 GLY GLY A . n A 1 20 LYS 20 18 18 LYS LYS A . n A 1 21 LYS 21 19 19 LYS LYS A . n A 1 22 GLY 22 20 20 GLY GLY A . n A 1 23 TYR 23 21 21 TYR TYR A . n A 1 24 ASP 24 22 22 ASP ASP A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 ALA 26 24 24 ALA ALA A . n A 1 27 THR 27 25 25 THR THR A . n A 1 28 THR 28 26 26 THR THR A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 GLU 30 28 28 GLU GLU A . n A 1 31 ILE 31 29 29 ILE ILE A . n A 1 32 ALA 32 30 30 ALA ALA A . n A 1 33 GLU 33 31 31 GLU GLU A . n A 1 34 LYS 34 32 32 LYS LYS A . n A 1 35 ALA 35 33 33 ALA ALA A . n A 1 36 GLY 36 34 34 GLY GLY A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 LYS 39 37 37 LYS LYS A . n A 1 40 GLY 40 38 38 GLY GLY A . n A 1 41 LEU 41 39 39 LEU LEU A . n A 1 42 ILE 42 40 40 ILE ILE A . n A 1 43 PHE 43 41 41 PHE PHE A . n A 1 44 HIS 44 42 42 HIS HIS A . n A 1 45 TYR 45 43 43 TYR TYR A . n A 1 46 PHE 46 44 44 PHE PHE A . n A 1 47 LYS 47 45 45 LYS LYS A . n A 1 48 ASN 48 46 46 ASN ASN A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 GLU 50 48 48 GLU GLU A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 TYR 53 51 51 TYR TYR A . n A 1 54 TYR 54 52 52 TYR TYR A . n A 1 55 GLN 55 53 53 GLN GLN A . n A 1 56 ALA 56 54 54 ALA ALA A . n A 1 57 TYR 57 55 55 TYR TYR A . n A 1 58 MSE 58 56 56 MSE MSE A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 VAL 60 58 58 VAL VAL A . n A 1 61 THR 61 59 59 THR THR A . n A 1 62 GLU 62 60 60 GLU GLU A . n A 1 63 LYS 63 61 61 LYS LYS A . n A 1 64 LEU 64 62 62 LEU LEU A . n A 1 65 GLN 65 63 63 GLN GLN A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 GLU 67 65 65 GLU GLU A . n A 1 68 PHE 68 66 66 PHE PHE A . n A 1 69 GLU 69 67 67 GLU GLU A . n A 1 70 ASN 70 68 68 ASN ASN A . n A 1 71 PHE 71 69 69 PHE PHE A . n A 1 72 LEU 72 70 70 LEU LEU A . n A 1 73 MSE 73 71 71 MSE MSE A . n A 1 74 LYS 74 72 72 LYS LYS A . n A 1 75 ASN 75 73 73 ASN ASN A . n A 1 76 ARG 76 74 74 ARG ARG A . n A 1 77 ASN 77 75 75 ASN ASN A . n A 1 78 ARG 78 76 76 ARG ARG A . n A 1 79 ASP 79 77 77 ASP ASP A . n A 1 80 ILE 80 78 78 ILE ILE A . n A 1 81 PHE 81 79 79 PHE PHE A . n A 1 82 ASP 82 80 80 ASP ASP A . n A 1 83 PHE 83 81 81 PHE PHE A . n A 1 84 MSE 84 82 82 MSE MSE A . n A 1 85 GLU 85 83 83 GLU GLU A . n A 1 86 ARG 86 84 84 ARG ARG A . n A 1 87 TRP 87 85 85 TRP TRP A . n A 1 88 ILE 88 86 86 ILE ILE A . n A 1 89 GLU 89 87 87 GLU GLU A . n A 1 90 LYS 90 88 88 LYS LYS A . n A 1 91 LYS 91 89 89 LYS LYS A . n A 1 92 LEU 92 90 90 LEU LEU A . n A 1 93 GLU 93 91 91 GLU GLU A . n A 1 94 TYR 94 92 92 TYR TYR A . n A 1 95 SER 95 93 93 SER SER A . n A 1 96 ALA 96 94 94 ALA ALA A . n A 1 97 SER 97 95 95 SER SER A . n A 1 98 HIS 98 96 96 HIS HIS A . n A 1 99 PRO 99 97 97 PRO PRO A . n A 1 100 GLU 100 98 98 GLU GLU A . n A 1 101 GLU 101 99 99 GLU GLU A . n A 1 102 ALA 102 100 100 ALA ALA A . n A 1 103 ASP 103 101 101 ASP ASP A . n A 1 104 PHE 104 102 102 PHE PHE A . n A 1 105 LEU 105 103 103 LEU LEU A . n A 1 106 ILE 106 104 104 ILE ILE A . n A 1 107 THR 107 105 105 THR THR A . n A 1 108 LEU 108 106 106 LEU LEU A . n A 1 109 VAL 109 107 107 VAL VAL A . n A 1 110 SER 110 108 108 SER SER A . n A 1 111 VAL 111 109 109 VAL VAL A . n A 1 112 ASP 112 110 110 ASP ASP A . n A 1 113 GLU 113 111 111 GLU GLU A . n A 1 114 GLY 114 112 112 GLY GLY A . n A 1 115 LEU 115 113 113 LEU LEU A . n A 1 116 ARG 116 114 114 ARG ARG A . n A 1 117 LYS 117 115 115 LYS LYS A . n A 1 118 ARG 118 116 116 ARG ARG A . n A 1 119 ILE 119 117 117 ILE ILE A . n A 1 120 LEU 120 118 118 LEU LEU A . n A 1 121 LEU 121 119 119 LEU LEU A . n A 1 122 ASP 122 120 120 ASP ASP A . n A 1 123 LEU 123 121 121 LEU LEU A . n A 1 124 GLU 124 122 122 GLU GLU A . n A 1 125 LYS 125 123 123 LYS LYS A . n A 1 126 SER 126 124 124 SER SER A . n A 1 127 GLN 127 125 125 GLN GLN A . n A 1 128 ARG 128 126 126 ARG ARG A . n A 1 129 VAL 129 127 127 VAL VAL A . n A 1 130 PHE 130 128 128 PHE PHE A . n A 1 131 PHE 131 129 129 PHE PHE A . n A 1 132 ASP 132 130 130 ASP ASP A . n A 1 133 PHE 133 131 131 PHE PHE A . n A 1 134 VAL 134 132 132 VAL VAL A . n A 1 135 ARG 135 133 133 ARG ARG A . n A 1 136 GLU 136 134 134 GLU GLU A . n A 1 137 LYS 137 135 135 LYS LYS A . n A 1 138 LEU 138 136 136 LEU LEU A . n A 1 139 LYS 139 137 137 LYS LYS A . n A 1 140 ASP 140 138 138 ASP ASP A . n A 1 141 LEU 141 139 139 LEU LEU A . n A 1 142 ASP 142 140 140 ASP ASP A . n A 1 143 LEU 143 141 141 LEU LEU A . n A 1 144 ALA 144 142 142 ALA ALA A . n A 1 145 GLU 145 143 143 GLU GLU A . n A 1 146 ASP 146 144 144 ASP ASP A . n A 1 147 VAL 147 145 145 VAL VAL A . n A 1 148 THR 148 146 146 THR THR A . n A 1 149 GLU 149 147 147 GLU GLU A . n A 1 150 GLU 150 148 148 GLU GLU A . n A 1 151 ILE 151 149 149 ILE ILE A . n A 1 152 ALA 152 150 150 ALA ALA A . n A 1 153 LEU 153 151 151 LEU LEU A . n A 1 154 LYS 154 152 152 LYS LYS A . n A 1 155 PHE 155 153 153 PHE PHE A . n A 1 156 LEU 156 154 154 LEU LEU A . n A 1 157 MSE 157 155 155 MSE MSE A . n A 1 158 TRP 158 156 156 TRP TRP A . n A 1 159 PHE 159 157 157 PHE PHE A . n A 1 160 PHE 160 158 158 PHE PHE A . n A 1 161 SER 161 159 159 SER SER A . n A 1 162 GLY 162 160 160 GLY GLY A . n A 1 163 PHE 163 161 161 PHE PHE A . n A 1 164 GLU 164 162 162 GLU GLU A . n A 1 165 GLU 165 163 163 GLU GLU A . n A 1 166 VAL 166 164 164 VAL VAL A . n A 1 167 TYR 167 165 165 TYR TYR A . n A 1 168 LEU 168 166 166 LEU LEU A . n A 1 169 ARG 169 167 167 ARG ARG A . n A 1 170 THR 170 168 168 THR THR A . n A 1 171 TYR 171 169 169 TYR TYR A . n A 1 172 GLN 172 170 170 GLN GLN A . n A 1 173 GLY 173 171 171 GLY GLY A . n A 1 174 LYS 174 172 172 LYS LYS A . n A 1 175 PRO 175 173 173 PRO PRO A . n A 1 176 GLU 176 174 174 GLU GLU A . n A 1 177 LEU 177 175 175 LEU LEU A . n A 1 178 LEU 178 176 176 LEU LEU A . n A 1 179 LYS 179 177 177 LYS LYS A . n A 1 180 ARG 180 178 178 ARG ARG A . n A 1 181 ASP 181 179 179 ASP ASP A . n A 1 182 MSE 182 180 180 MSE MSE A . n A 1 183 ASN 183 181 181 ASN ASN A . n A 1 184 THR 184 182 182 THR THR A . n A 1 185 LEU 185 183 183 LEU LEU A . n A 1 186 VAL 186 184 184 VAL VAL A . n A 1 187 GLU 187 185 185 GLU GLU A . n A 1 188 GLU 188 186 186 GLU GLU A . n A 1 189 VAL 189 187 187 VAL VAL A . n A 1 190 LYS 190 188 188 LYS LYS A . n A 1 191 VAL 191 189 189 VAL VAL A . n A 1 192 MSE 192 190 190 MSE MSE A . n A 1 193 LEU 193 191 191 LEU LEU A . n A 1 194 ARG 194 192 192 ARG ARG A . n A 1 195 ILE 195 193 193 ILE ILE A . n A 1 196 LEU 196 194 194 LEU LEU A . n A 1 197 LYS 197 195 195 LYS LYS A . n A 1 198 LYS 198 196 196 LYS LYS A . n A 1 199 GLY 199 197 197 GLY GLY A . n A 1 200 MSE 200 198 198 MSE MSE A . n A 1 201 THR 201 199 199 THR THR A . n A 1 202 LYS 202 200 200 LYS LYS A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 3 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 58 A MSE 56 ? MET SELENOMETHIONINE 3 A MSE 73 A MSE 71 ? MET SELENOMETHIONINE 4 A MSE 84 A MSE 82 ? MET SELENOMETHIONINE 5 A MSE 157 A MSE 155 ? MET SELENOMETHIONINE 6 A MSE 182 A MSE 180 ? MET SELENOMETHIONINE 7 A MSE 192 A MSE 190 ? MET SELENOMETHIONINE 8 A MSE 200 A MSE 198 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 66.0120000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 1128 ? C HOH . 2 1 A HOH 1144 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-28 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 REFMAC refinement 5.2 ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 CCP4 phasing . ? 5 Coot 'model building' . ? 6 REFMAC phasing . ? 7 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 SE A MSE 56 ? ? CE A MSE 56 ? ? 1.303 1.950 -0.647 0.059 N 2 1 CB A MSE 180 ? ? CG A MSE 180 ? ? 1.708 1.520 0.188 0.030 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MSE 56 ? ? SE A MSE 56 ? ? CE A MSE 56 ? ? 80.67 98.90 -18.23 2.20 N 2 1 CB A MSE 180 ? ? CG A MSE 180 ? ? SE A MSE 180 ? ? 94.51 112.70 -18.19 3.00 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 45 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 69.36 _pdbx_validate_torsion.psi -58.57 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 18 ? CE ? A LYS 20 CE 2 1 Y 1 A LYS 18 ? NZ ? A LYS 20 NZ 3 1 Y 1 A GLU 31 ? CG ? A GLU 33 CG 4 1 Y 1 A GLU 31 ? CD ? A GLU 33 CD 5 1 Y 1 A GLU 31 ? OE1 ? A GLU 33 OE1 6 1 Y 1 A GLU 31 ? OE2 ? A GLU 33 OE2 7 1 Y 1 A LYS 37 ? CD ? A LYS 39 CD 8 1 Y 1 A LYS 37 ? CE ? A LYS 39 CE 9 1 Y 1 A LYS 37 ? NZ ? A LYS 39 NZ 10 1 Y 1 A LYS 45 ? CE ? A LYS 47 CE 11 1 Y 1 A LYS 45 ? NZ ? A LYS 47 NZ 12 1 Y 1 A GLU 60 ? OE1 ? A GLU 62 OE1 13 1 Y 1 A GLU 60 ? OE2 ? A GLU 62 OE2 14 1 Y 1 A LYS 61 ? NZ ? A LYS 63 NZ 15 1 Y 1 A LYS 64 ? CE ? A LYS 66 CE 16 1 Y 1 A LYS 64 ? NZ ? A LYS 66 NZ 17 1 Y 1 A LYS 89 ? CE ? A LYS 91 CE 18 1 Y 1 A LYS 89 ? NZ ? A LYS 91 NZ 19 1 Y 1 A GLU 91 ? CG ? A GLU 93 CG 20 1 Y 1 A GLU 91 ? CD ? A GLU 93 CD 21 1 Y 1 A GLU 91 ? OE1 ? A GLU 93 OE1 22 1 Y 1 A GLU 91 ? OE2 ? A GLU 93 OE2 23 1 Y 1 A ILE 104 ? CD1 ? A ILE 106 CD1 24 1 Y 1 A GLU 111 ? CG ? A GLU 113 CG 25 1 Y 1 A GLU 111 ? CD ? A GLU 113 CD 26 1 Y 1 A GLU 111 ? OE1 ? A GLU 113 OE1 27 1 Y 1 A GLU 111 ? OE2 ? A GLU 113 OE2 28 1 Y 1 A LYS 115 ? CE ? A LYS 117 CE 29 1 Y 1 A LYS 115 ? NZ ? A LYS 117 NZ 30 1 Y 1 A LYS 123 ? CE ? A LYS 125 CE 31 1 Y 1 A LYS 123 ? NZ ? A LYS 125 NZ 32 1 Y 1 A ARG 133 ? CZ ? A ARG 135 CZ 33 1 Y 1 A ARG 133 ? NH1 ? A ARG 135 NH1 34 1 Y 1 A ARG 133 ? NH2 ? A ARG 135 NH2 35 1 Y 1 A LYS 137 ? NZ ? A LYS 139 NZ 36 1 Y 1 A GLU 143 ? CB ? A GLU 145 CB 37 1 Y 1 A GLU 143 ? CG ? A GLU 145 CG 38 1 Y 1 A GLU 143 ? CD ? A GLU 145 CD 39 1 Y 1 A GLU 143 ? OE1 ? A GLU 145 OE1 40 1 Y 1 A GLU 143 ? OE2 ? A GLU 145 OE2 41 1 Y 1 A ILE 149 ? CD1 ? A ILE 151 CD1 42 1 Y 1 A LYS 172 ? CD ? A LYS 174 CD 43 1 Y 1 A LYS 172 ? CE ? A LYS 174 CE 44 1 Y 1 A LYS 172 ? NZ ? A LYS 174 NZ 45 1 Y 1 A ARG 178 ? CG ? A ARG 180 CG 46 1 Y 1 A ARG 178 ? CD ? A ARG 180 CD 47 1 Y 1 A ARG 178 ? NE ? A ARG 180 NE 48 1 Y 1 A ARG 178 ? CZ ? A ARG 180 CZ 49 1 Y 1 A ARG 178 ? NH1 ? A ARG 180 NH1 50 1 Y 1 A ARG 178 ? NH2 ? A ARG 180 NH2 51 1 Y 1 A LYS 200 ? CD ? A LYS 202 CD 52 1 Y 1 A LYS 200 ? CE ? A LYS 202 CE 53 1 Y 1 A LYS 200 ? NZ ? A LYS 202 NZ # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 1001 1001 EDO EGL A . C 3 HOH 1 1002 1 HOH HOH A . C 3 HOH 2 1003 2 HOH HOH A . C 3 HOH 3 1004 3 HOH HOH A . C 3 HOH 4 1005 4 HOH HOH A . C 3 HOH 5 1006 5 HOH HOH A . C 3 HOH 6 1007 6 HOH HOH A . C 3 HOH 7 1008 7 HOH HOH A . C 3 HOH 8 1009 8 HOH HOH A . C 3 HOH 9 1010 9 HOH HOH A . C 3 HOH 10 1011 10 HOH HOH A . C 3 HOH 11 1012 11 HOH HOH A . C 3 HOH 12 1013 12 HOH HOH A . C 3 HOH 13 1014 13 HOH HOH A . C 3 HOH 14 1015 14 HOH HOH A . C 3 HOH 15 1016 15 HOH HOH A . C 3 HOH 16 1017 16 HOH HOH A . C 3 HOH 17 1018 17 HOH HOH A . C 3 HOH 18 1019 18 HOH HOH A . C 3 HOH 19 1020 19 HOH HOH A . C 3 HOH 20 1021 20 HOH HOH A . C 3 HOH 21 1022 21 HOH HOH A . C 3 HOH 22 1023 22 HOH HOH A . C 3 HOH 23 1024 23 HOH HOH A . C 3 HOH 24 1025 24 HOH HOH A . C 3 HOH 25 1026 25 HOH HOH A . C 3 HOH 26 1027 26 HOH HOH A . C 3 HOH 27 1028 27 HOH HOH A . C 3 HOH 28 1029 28 HOH HOH A . C 3 HOH 29 1030 29 HOH HOH A . C 3 HOH 30 1031 30 HOH HOH A . C 3 HOH 31 1032 31 HOH HOH A . C 3 HOH 32 1033 32 HOH HOH A . C 3 HOH 33 1034 33 HOH HOH A . C 3 HOH 34 1035 34 HOH HOH A . C 3 HOH 35 1036 35 HOH HOH A . C 3 HOH 36 1037 36 HOH HOH A . C 3 HOH 37 1038 37 HOH HOH A . C 3 HOH 38 1039 38 HOH HOH A . C 3 HOH 39 1040 39 HOH HOH A . C 3 HOH 40 1041 40 HOH HOH A . C 3 HOH 41 1042 41 HOH HOH A . C 3 HOH 42 1043 42 HOH HOH A . C 3 HOH 43 1044 43 HOH HOH A . C 3 HOH 44 1045 44 HOH HOH A . C 3 HOH 45 1046 45 HOH HOH A . C 3 HOH 46 1047 46 HOH HOH A . C 3 HOH 47 1048 47 HOH HOH A . C 3 HOH 48 1049 48 HOH HOH A . C 3 HOH 49 1050 49 HOH HOH A . C 3 HOH 50 1051 50 HOH HOH A . C 3 HOH 51 1052 51 HOH HOH A . C 3 HOH 52 1053 52 HOH HOH A . C 3 HOH 53 1054 53 HOH HOH A . C 3 HOH 54 1055 54 HOH HOH A . C 3 HOH 55 1056 55 HOH HOH A . C 3 HOH 56 1057 56 HOH HOH A . C 3 HOH 57 1058 57 HOH HOH A . C 3 HOH 58 1059 58 HOH HOH A . C 3 HOH 59 1060 59 HOH HOH A . C 3 HOH 60 1061 60 HOH HOH A . C 3 HOH 61 1062 61 HOH HOH A . C 3 HOH 62 1063 62 HOH HOH A . C 3 HOH 63 1064 63 HOH HOH A . C 3 HOH 64 1065 64 HOH HOH A . C 3 HOH 65 1066 65 HOH HOH A . C 3 HOH 66 1067 66 HOH HOH A . C 3 HOH 67 1068 67 HOH HOH A . C 3 HOH 68 1069 68 HOH HOH A . C 3 HOH 69 1070 69 HOH HOH A . C 3 HOH 70 1071 70 HOH HOH A . C 3 HOH 71 1072 71 HOH HOH A . C 3 HOH 72 1073 72 HOH HOH A . C 3 HOH 73 1074 73 HOH HOH A . C 3 HOH 74 1075 74 HOH HOH A . C 3 HOH 75 1076 75 HOH HOH A . C 3 HOH 76 1077 76 HOH HOH A . C 3 HOH 77 1078 77 HOH HOH A . C 3 HOH 78 1079 78 HOH HOH A . C 3 HOH 79 1080 79 HOH HOH A . C 3 HOH 80 1081 80 HOH HOH A . C 3 HOH 81 1082 81 HOH HOH A . C 3 HOH 82 1083 82 HOH HOH A . C 3 HOH 83 1084 83 HOH HOH A . C 3 HOH 84 1085 84 HOH HOH A . C 3 HOH 85 1086 85 HOH HOH A . C 3 HOH 86 1087 86 HOH HOH A . C 3 HOH 87 1088 87 HOH HOH A . C 3 HOH 88 1089 88 HOH HOH A . C 3 HOH 89 1090 89 HOH HOH A . C 3 HOH 90 1091 90 HOH HOH A . C 3 HOH 91 1092 91 HOH HOH A . C 3 HOH 92 1093 92 HOH HOH A . C 3 HOH 93 1094 93 HOH HOH A . C 3 HOH 94 1095 94 HOH HOH A . C 3 HOH 95 1096 95 HOH HOH A . C 3 HOH 96 1097 96 HOH HOH A . C 3 HOH 97 1098 97 HOH HOH A . C 3 HOH 98 1099 98 HOH HOH A . C 3 HOH 99 1100 99 HOH HOH A . C 3 HOH 100 1101 100 HOH HOH A . C 3 HOH 101 1102 101 HOH HOH A . C 3 HOH 102 1103 102 HOH HOH A . C 3 HOH 103 1104 103 HOH HOH A . C 3 HOH 104 1105 104 HOH HOH A . C 3 HOH 105 1106 105 HOH HOH A . C 3 HOH 106 1107 106 HOH HOH A . C 3 HOH 107 1108 107 HOH HOH A . C 3 HOH 108 1109 108 HOH HOH A . C 3 HOH 109 1110 109 HOH HOH A . C 3 HOH 110 1111 110 HOH HOH A . C 3 HOH 111 1112 111 HOH HOH A . C 3 HOH 112 1113 112 HOH HOH A . C 3 HOH 113 1114 113 HOH HOH A . C 3 HOH 114 1115 114 HOH HOH A . C 3 HOH 115 1116 115 HOH HOH A . C 3 HOH 116 1117 116 HOH HOH A . C 3 HOH 117 1118 117 HOH HOH A . C 3 HOH 118 1119 118 HOH HOH A . C 3 HOH 119 1120 119 HOH HOH A . C 3 HOH 120 1121 120 HOH HOH A . C 3 HOH 121 1122 121 HOH HOH A . C 3 HOH 122 1123 122 HOH HOH A . C 3 HOH 123 1124 123 HOH HOH A . C 3 HOH 124 1125 124 HOH HOH A . C 3 HOH 125 1126 125 HOH HOH A . C 3 HOH 126 1127 126 HOH HOH A . C 3 HOH 127 1128 127 HOH HOH A . C 3 HOH 128 1129 128 HOH HOH A . C 3 HOH 129 1130 129 HOH HOH A . C 3 HOH 130 1131 130 HOH HOH A . C 3 HOH 131 1132 131 HOH HOH A . C 3 HOH 132 1133 132 HOH HOH A . C 3 HOH 133 1134 133 HOH HOH A . C 3 HOH 134 1135 134 HOH HOH A . C 3 HOH 135 1136 135 HOH HOH A . C 3 HOH 136 1137 136 HOH HOH A . C 3 HOH 137 1138 137 HOH HOH A . C 3 HOH 138 1139 138 HOH HOH A . C 3 HOH 139 1140 139 HOH HOH A . C 3 HOH 140 1141 140 HOH HOH A . C 3 HOH 141 1142 141 HOH HOH A . C 3 HOH 142 1143 142 HOH HOH A . C 3 HOH 143 1144 143 HOH HOH A . C 3 HOH 144 1145 144 HOH HOH A . C 3 HOH 145 1146 145 HOH HOH A . C 3 HOH 146 1147 146 HOH HOH A . C 3 HOH 147 1148 147 HOH HOH A . C 3 HOH 148 1149 148 HOH HOH A . C 3 HOH 149 1150 149 HOH HOH A . C 3 HOH 150 1151 150 HOH HOH A . C 3 HOH 151 1152 151 HOH HOH A . #