data_2IGR # _entry.id 2IGR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2IGR pdb_00002igr 10.2210/pdb2igr/pdb RCSB RCSB039550 ? ? WWPDB D_1000039550 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-18 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_entry_details 5 4 'Structure model' pdbx_modification_feature 6 4 'Structure model' pdbx_nmr_spectrometer 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_entry_details.has_protein_modification' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 2IGR _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2006-09-24 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1D9J 'Custom Cecropin' unspecified PDB 1D9M 'Custom Cecropin' unspecified PDB 1D9O 'Custom Cecropin' unspecified PDB 1D9P 'Custom Cecropin' unspecified # _audit_author.name 'Wu, J.-M.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Structure and function of a custom anticancer peptide, CB1a' _citation.journal_abbrev Peptides _citation.journal_volume 30 _citation.page_first 839 _citation.page_last 848 _citation.year 2009 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 0196-9781 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19428759 _citation.pdbx_database_id_DOI 10.1016/j.peptides.2009.02.004 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, J.-M.' 1 ? primary 'Jan, P.-S.' 2 ? primary 'Yu, H.-C.' 3 ? primary 'Haung, H.-Y.' 4 ? primary 'Fang, H.-J.' 5 ? primary 'Chang, Y.-I.' 6 ? primary 'Cheng, J.-W.' 7 ? primary 'Chen, H.M.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Anticancer peptide CB1a' _entity.formula_weight 4203.322 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'KWKVFKKIEKKWKVFKKIEKAGPKWKVFKKIEK(NH2)' _entity_poly.pdbx_seq_one_letter_code_can KWKVFKKIEKKWKVFKKIEKAGPKWKVFKKIEKX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 TRP n 1 3 LYS n 1 4 VAL n 1 5 PHE n 1 6 LYS n 1 7 LYS n 1 8 ILE n 1 9 GLU n 1 10 LYS n 1 11 LYS n 1 12 TRP n 1 13 LYS n 1 14 VAL n 1 15 PHE n 1 16 LYS n 1 17 LYS n 1 18 ILE n 1 19 GLU n 1 20 LYS n 1 21 ALA n 1 22 GLY n 1 23 PRO n 1 24 LYS n 1 25 TRP n 1 26 LYS n 1 27 VAL n 1 28 PHE n 1 29 LYS n 1 30 LYS n 1 31 ILE n 1 32 GLU n 1 33 LYS n 1 34 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Hyalophora cecropia' _pdbx_entity_src_syn.organism_common_name 'Cecropia moth' _pdbx_entity_src_syn.ncbi_taxonomy_id 7123 _pdbx_entity_src_syn.details 'This peptide was designed from Cecropin B and chemically synthesized.' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 TRP 2 2 2 TRP TRP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 NH2 34 34 33 NH2 LYS A . n # _exptl.entry_id 2IGR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2IGR _struct.title 'Solution structure of CB1a, a novel anticancer peptide derived from natural antimicrobial peptide cecropin B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2IGR _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN, LIPID BINDING PROTEIN' _struct_keywords.text ;Anticancer peptide, cecropin, antimicrobial peptide, ploycationic peptide, cecropin fingerprint sequence, DE NOVO PROTEIN, LIPID BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2IGR _struct_ref.pdbx_db_accession 2IGR _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code KWKVFKKIEKKWKVFKKIEKAGPKWKVFKKIEKX _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2IGR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2IGR _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 34 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 3 ? GLY A 22 ? LYS A 3 GLY A 22 1 ? 20 HELX_P HELX_P2 2 PRO A 23 ? LYS A 33 ? PRO A 23 LYS A 33 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 33 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 34 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 33 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 34 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.305 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NH2 _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 34 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id LYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 33 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id NH2 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 34 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id LYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 33 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 20 _pdbx_modification_feature.ref_comp_id NH2 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal amidation' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 34 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 34' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 GLU A 32 ? GLU A 32 . ? 1_555 ? 2 AC1 2 LYS A 33 ? LYS A 33 . ? 1_555 ? # _pdbx_entry_details.entry_id 2IGR _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;IN THIS ENTRY, THE PROTEIN WAS CONSTRUCTED BY REPEATING THE ORIGINAL N-TERMINAL TEN AMINO ACIDS OF CECROPIN-B, KWKVFKKIEK, THREE TIMES AND RETAINING A CONSERVED HINGE SEQUENCE (ALA-GLY-PRO) OF CECROPINS BETWEEN THE SECOND AND THE THIRD REPEAT. ; _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 23 ? ? -79.46 45.21 2 5 PRO A 23 ? ? -79.38 46.35 3 14 PRO A 23 ? ? -79.17 44.63 4 18 TRP A 2 ? ? 56.95 -84.16 # _pdbx_nmr_ensemble.entry_id 2IGR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2IGR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '3mM CB1a peptide; 20% d-HFP; 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY # _pdbx_nmr_refine.entry_id 2IGR _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 'XPLOR-NIH 2.1.09' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors 'Brunger A. T. etall' _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 GLU N N N N 14 GLU CA C N S 15 GLU C C N N 16 GLU O O N N 17 GLU CB C N N 18 GLU CG C N N 19 GLU CD C N N 20 GLU OE1 O N N 21 GLU OE2 O N N 22 GLU OXT O N N 23 GLU H H N N 24 GLU H2 H N N 25 GLU HA H N N 26 GLU HB2 H N N 27 GLU HB3 H N N 28 GLU HG2 H N N 29 GLU HG3 H N N 30 GLU HE2 H N N 31 GLU HXT H N N 32 GLY N N N N 33 GLY CA C N N 34 GLY C C N N 35 GLY O O N N 36 GLY OXT O N N 37 GLY H H N N 38 GLY H2 H N N 39 GLY HA2 H N N 40 GLY HA3 H N N 41 GLY HXT H N N 42 ILE N N N N 43 ILE CA C N S 44 ILE C C N N 45 ILE O O N N 46 ILE CB C N S 47 ILE CG1 C N N 48 ILE CG2 C N N 49 ILE CD1 C N N 50 ILE OXT O N N 51 ILE H H N N 52 ILE H2 H N N 53 ILE HA H N N 54 ILE HB H N N 55 ILE HG12 H N N 56 ILE HG13 H N N 57 ILE HG21 H N N 58 ILE HG22 H N N 59 ILE HG23 H N N 60 ILE HD11 H N N 61 ILE HD12 H N N 62 ILE HD13 H N N 63 ILE HXT H N N 64 LYS N N N N 65 LYS CA C N S 66 LYS C C N N 67 LYS O O N N 68 LYS CB C N N 69 LYS CG C N N 70 LYS CD C N N 71 LYS CE C N N 72 LYS NZ N N N 73 LYS OXT O N N 74 LYS H H N N 75 LYS H2 H N N 76 LYS HA H N N 77 LYS HB2 H N N 78 LYS HB3 H N N 79 LYS HG2 H N N 80 LYS HG3 H N N 81 LYS HD2 H N N 82 LYS HD3 H N N 83 LYS HE2 H N N 84 LYS HE3 H N N 85 LYS HZ1 H N N 86 LYS HZ2 H N N 87 LYS HZ3 H N N 88 LYS HXT H N N 89 NH2 N N N N 90 NH2 HN1 H N N 91 NH2 HN2 H N N 92 PHE N N N N 93 PHE CA C N S 94 PHE C C N N 95 PHE O O N N 96 PHE CB C N N 97 PHE CG C Y N 98 PHE CD1 C Y N 99 PHE CD2 C Y N 100 PHE CE1 C Y N 101 PHE CE2 C Y N 102 PHE CZ C Y N 103 PHE OXT O N N 104 PHE H H N N 105 PHE H2 H N N 106 PHE HA H N N 107 PHE HB2 H N N 108 PHE HB3 H N N 109 PHE HD1 H N N 110 PHE HD2 H N N 111 PHE HE1 H N N 112 PHE HE2 H N N 113 PHE HZ H N N 114 PHE HXT H N N 115 PRO N N N N 116 PRO CA C N S 117 PRO C C N N 118 PRO O O N N 119 PRO CB C N N 120 PRO CG C N N 121 PRO CD C N N 122 PRO OXT O N N 123 PRO H H N N 124 PRO HA H N N 125 PRO HB2 H N N 126 PRO HB3 H N N 127 PRO HG2 H N N 128 PRO HG3 H N N 129 PRO HD2 H N N 130 PRO HD3 H N N 131 PRO HXT H N N 132 TRP N N N N 133 TRP CA C N S 134 TRP C C N N 135 TRP O O N N 136 TRP CB C N N 137 TRP CG C Y N 138 TRP CD1 C Y N 139 TRP CD2 C Y N 140 TRP NE1 N Y N 141 TRP CE2 C Y N 142 TRP CE3 C Y N 143 TRP CZ2 C Y N 144 TRP CZ3 C Y N 145 TRP CH2 C Y N 146 TRP OXT O N N 147 TRP H H N N 148 TRP H2 H N N 149 TRP HA H N N 150 TRP HB2 H N N 151 TRP HB3 H N N 152 TRP HD1 H N N 153 TRP HE1 H N N 154 TRP HE3 H N N 155 TRP HZ2 H N N 156 TRP HZ3 H N N 157 TRP HH2 H N N 158 TRP HXT H N N 159 VAL N N N N 160 VAL CA C N S 161 VAL C C N N 162 VAL O O N N 163 VAL CB C N N 164 VAL CG1 C N N 165 VAL CG2 C N N 166 VAL OXT O N N 167 VAL H H N N 168 VAL H2 H N N 169 VAL HA H N N 170 VAL HB H N N 171 VAL HG11 H N N 172 VAL HG12 H N N 173 VAL HG13 H N N 174 VAL HG21 H N N 175 VAL HG22 H N N 176 VAL HG23 H N N 177 VAL HXT H N N 178 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 GLU N CA sing N N 13 GLU N H sing N N 14 GLU N H2 sing N N 15 GLU CA C sing N N 16 GLU CA CB sing N N 17 GLU CA HA sing N N 18 GLU C O doub N N 19 GLU C OXT sing N N 20 GLU CB CG sing N N 21 GLU CB HB2 sing N N 22 GLU CB HB3 sing N N 23 GLU CG CD sing N N 24 GLU CG HG2 sing N N 25 GLU CG HG3 sing N N 26 GLU CD OE1 doub N N 27 GLU CD OE2 sing N N 28 GLU OE2 HE2 sing N N 29 GLU OXT HXT sing N N 30 GLY N CA sing N N 31 GLY N H sing N N 32 GLY N H2 sing N N 33 GLY CA C sing N N 34 GLY CA HA2 sing N N 35 GLY CA HA3 sing N N 36 GLY C O doub N N 37 GLY C OXT sing N N 38 GLY OXT HXT sing N N 39 ILE N CA sing N N 40 ILE N H sing N N 41 ILE N H2 sing N N 42 ILE CA C sing N N 43 ILE CA CB sing N N 44 ILE CA HA sing N N 45 ILE C O doub N N 46 ILE C OXT sing N N 47 ILE CB CG1 sing N N 48 ILE CB CG2 sing N N 49 ILE CB HB sing N N 50 ILE CG1 CD1 sing N N 51 ILE CG1 HG12 sing N N 52 ILE CG1 HG13 sing N N 53 ILE CG2 HG21 sing N N 54 ILE CG2 HG22 sing N N 55 ILE CG2 HG23 sing N N 56 ILE CD1 HD11 sing N N 57 ILE CD1 HD12 sing N N 58 ILE CD1 HD13 sing N N 59 ILE OXT HXT sing N N 60 LYS N CA sing N N 61 LYS N H sing N N 62 LYS N H2 sing N N 63 LYS CA C sing N N 64 LYS CA CB sing N N 65 LYS CA HA sing N N 66 LYS C O doub N N 67 LYS C OXT sing N N 68 LYS CB CG sing N N 69 LYS CB HB2 sing N N 70 LYS CB HB3 sing N N 71 LYS CG CD sing N N 72 LYS CG HG2 sing N N 73 LYS CG HG3 sing N N 74 LYS CD CE sing N N 75 LYS CD HD2 sing N N 76 LYS CD HD3 sing N N 77 LYS CE NZ sing N N 78 LYS CE HE2 sing N N 79 LYS CE HE3 sing N N 80 LYS NZ HZ1 sing N N 81 LYS NZ HZ2 sing N N 82 LYS NZ HZ3 sing N N 83 LYS OXT HXT sing N N 84 NH2 N HN1 sing N N 85 NH2 N HN2 sing N N 86 PHE N CA sing N N 87 PHE N H sing N N 88 PHE N H2 sing N N 89 PHE CA C sing N N 90 PHE CA CB sing N N 91 PHE CA HA sing N N 92 PHE C O doub N N 93 PHE C OXT sing N N 94 PHE CB CG sing N N 95 PHE CB HB2 sing N N 96 PHE CB HB3 sing N N 97 PHE CG CD1 doub Y N 98 PHE CG CD2 sing Y N 99 PHE CD1 CE1 sing Y N 100 PHE CD1 HD1 sing N N 101 PHE CD2 CE2 doub Y N 102 PHE CD2 HD2 sing N N 103 PHE CE1 CZ doub Y N 104 PHE CE1 HE1 sing N N 105 PHE CE2 CZ sing Y N 106 PHE CE2 HE2 sing N N 107 PHE CZ HZ sing N N 108 PHE OXT HXT sing N N 109 PRO N CA sing N N 110 PRO N CD sing N N 111 PRO N H sing N N 112 PRO CA C sing N N 113 PRO CA CB sing N N 114 PRO CA HA sing N N 115 PRO C O doub N N 116 PRO C OXT sing N N 117 PRO CB CG sing N N 118 PRO CB HB2 sing N N 119 PRO CB HB3 sing N N 120 PRO CG CD sing N N 121 PRO CG HG2 sing N N 122 PRO CG HG3 sing N N 123 PRO CD HD2 sing N N 124 PRO CD HD3 sing N N 125 PRO OXT HXT sing N N 126 TRP N CA sing N N 127 TRP N H sing N N 128 TRP N H2 sing N N 129 TRP CA C sing N N 130 TRP CA CB sing N N 131 TRP CA HA sing N N 132 TRP C O doub N N 133 TRP C OXT sing N N 134 TRP CB CG sing N N 135 TRP CB HB2 sing N N 136 TRP CB HB3 sing N N 137 TRP CG CD1 doub Y N 138 TRP CG CD2 sing Y N 139 TRP CD1 NE1 sing Y N 140 TRP CD1 HD1 sing N N 141 TRP CD2 CE2 doub Y N 142 TRP CD2 CE3 sing Y N 143 TRP NE1 CE2 sing Y N 144 TRP NE1 HE1 sing N N 145 TRP CE2 CZ2 sing Y N 146 TRP CE3 CZ3 doub Y N 147 TRP CE3 HE3 sing N N 148 TRP CZ2 CH2 doub Y N 149 TRP CZ2 HZ2 sing N N 150 TRP CZ3 CH2 sing Y N 151 TRP CZ3 HZ3 sing N N 152 TRP CH2 HH2 sing N N 153 TRP OXT HXT sing N N 154 VAL N CA sing N N 155 VAL N H sing N N 156 VAL N H2 sing N N 157 VAL CA C sing N N 158 VAL CA CB sing N N 159 VAL CA HA sing N N 160 VAL C O doub N N 161 VAL C OXT sing N N 162 VAL CB CG1 sing N N 163 VAL CB CG2 sing N N 164 VAL CB HB sing N N 165 VAL CG1 HG11 sing N N 166 VAL CG1 HG12 sing N N 167 VAL CG1 HG13 sing N N 168 VAL CG2 HG21 sing N N 169 VAL CG2 HG22 sing N N 170 VAL CG2 HG23 sing N N 171 VAL OXT HXT sing N N 172 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 2IGR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_