data_2IVP # _entry.id 2IVP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2IVP PDBE EBI-29117 WWPDB D_1290029117 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2IVN unspecified 'STRUCTURE OF UP1 PROTEIN' PDB 2IVO unspecified 'STRUCTURE OF UP1 PROTEIN' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2IVP _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-06-14 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hecker, A.' 1 'Leulliot, N.' 2 'Graille, M.' 3 'Dorlet, P.' 4 'Quevillon-Cheruel, S.' 5 'Ulryck, N.' 6 'Van Tilbeurgh, H.' 7 'Forterre, P.' 8 # _citation.id primary _citation.title ;An Archaeal Orthologue of the Universal Protein Kae1 is an Iron Metalloprotein which Exhibits Atypical DNA-Binding Properties and Apurinic-Endonuclease Activity in Vitro. ; _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 35 _citation.page_first 6042 _citation.page_last ? _citation.year 2007 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17766251 _citation.pdbx_database_id_DOI 10.1093/NAR/GKM554 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hecker, A.' 1 primary 'Leulliot, N.' 2 primary 'Gadelle, D.' 3 primary 'Graille, M.' 4 primary 'Justome, A.' 5 primary 'Dorlet, P.' 6 primary 'Brochier, C.' 7 primary 'Quevillon-Cheruel, S.' 8 primary 'Le Cam, E.' 9 primary 'Van Tilbeurgh, H.' 10 primary 'Forterre, P.' 11 # _cell.entry_id 2IVP _cell.length_a 61.688 _cell.length_b 69.914 _cell.length_c 74.306 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2IVP _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'O-SIALOGLYCOPROTEIN ENDOPEPTIDASE' 36244.828 1 3.4.24.57 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 1 ? ? ? ? 3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UP1, GLYCOPROTEASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGL GPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDV FARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAV AHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEV EIVWHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGL GPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDV FARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAV AHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEV EIVWHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 ALA n 1 4 LEU n 1 5 GLY n 1 6 ILE n 1 7 GLU n 1 8 GLY n 1 9 THR n 1 10 ALA n 1 11 HIS n 1 12 THR n 1 13 LEU n 1 14 GLY n 1 15 ILE n 1 16 GLY n 1 17 ILE n 1 18 VAL n 1 19 SER n 1 20 GLU n 1 21 ASP n 1 22 LYS n 1 23 VAL n 1 24 LEU n 1 25 ALA n 1 26 ASN n 1 27 VAL n 1 28 PHE n 1 29 ASP n 1 30 THR n 1 31 LEU n 1 32 THR n 1 33 THR n 1 34 GLU n 1 35 LYS n 1 36 GLY n 1 37 GLY n 1 38 ILE n 1 39 HIS n 1 40 PRO n 1 41 LYS n 1 42 GLU n 1 43 ALA n 1 44 ALA n 1 45 GLU n 1 46 HIS n 1 47 HIS n 1 48 ALA n 1 49 ARG n 1 50 LEU n 1 51 MET n 1 52 LYS n 1 53 PRO n 1 54 LEU n 1 55 LEU n 1 56 ARG n 1 57 LYS n 1 58 ALA n 1 59 LEU n 1 60 SER n 1 61 GLU n 1 62 ALA n 1 63 GLY n 1 64 VAL n 1 65 SER n 1 66 LEU n 1 67 ASP n 1 68 ASP n 1 69 ILE n 1 70 ASP n 1 71 VAL n 1 72 ILE n 1 73 ALA n 1 74 PHE n 1 75 SER n 1 76 GLN n 1 77 GLY n 1 78 PRO n 1 79 GLY n 1 80 LEU n 1 81 GLY n 1 82 PRO n 1 83 ALA n 1 84 LEU n 1 85 ARG n 1 86 VAL n 1 87 VAL n 1 88 ALA n 1 89 THR n 1 90 ALA n 1 91 ALA n 1 92 ARG n 1 93 ALA n 1 94 LEU n 1 95 ALA n 1 96 VAL n 1 97 LYS n 1 98 TYR n 1 99 ARG n 1 100 LYS n 1 101 PRO n 1 102 ILE n 1 103 VAL n 1 104 GLY n 1 105 VAL n 1 106 ASN n 1 107 HIS n 1 108 CYS n 1 109 ILE n 1 110 ALA n 1 111 HIS n 1 112 VAL n 1 113 GLU n 1 114 ILE n 1 115 THR n 1 116 LYS n 1 117 MET n 1 118 PHE n 1 119 GLY n 1 120 VAL n 1 121 LYS n 1 122 ASP n 1 123 PRO n 1 124 VAL n 1 125 GLY n 1 126 LEU n 1 127 TYR n 1 128 VAL n 1 129 SER n 1 130 GLY n 1 131 GLY n 1 132 ASN n 1 133 THR n 1 134 GLN n 1 135 VAL n 1 136 LEU n 1 137 ALA n 1 138 LEU n 1 139 GLU n 1 140 GLY n 1 141 GLY n 1 142 ARG n 1 143 TYR n 1 144 ARG n 1 145 VAL n 1 146 PHE n 1 147 GLY n 1 148 GLU n 1 149 THR n 1 150 LEU n 1 151 ASP n 1 152 ILE n 1 153 GLY n 1 154 ILE n 1 155 GLY n 1 156 ASN n 1 157 ALA n 1 158 ILE n 1 159 ASP n 1 160 VAL n 1 161 PHE n 1 162 ALA n 1 163 ARG n 1 164 GLU n 1 165 LEU n 1 166 GLY n 1 167 LEU n 1 168 GLY n 1 169 PHE n 1 170 PRO n 1 171 GLY n 1 172 GLY n 1 173 PRO n 1 174 LYS n 1 175 VAL n 1 176 GLU n 1 177 LYS n 1 178 LEU n 1 179 ALA n 1 180 GLU n 1 181 LYS n 1 182 GLY n 1 183 GLU n 1 184 LYS n 1 185 TYR n 1 186 ILE n 1 187 GLU n 1 188 LEU n 1 189 PRO n 1 190 TYR n 1 191 ALA n 1 192 VAL n 1 193 LYS n 1 194 GLY n 1 195 MET n 1 196 ASP n 1 197 LEU n 1 198 SER n 1 199 PHE n 1 200 SER n 1 201 GLY n 1 202 LEU n 1 203 LEU n 1 204 THR n 1 205 GLU n 1 206 ALA n 1 207 ILE n 1 208 ARG n 1 209 LYS n 1 210 TYR n 1 211 ARG n 1 212 SER n 1 213 GLY n 1 214 LYS n 1 215 TYR n 1 216 ARG n 1 217 VAL n 1 218 GLU n 1 219 ASP n 1 220 LEU n 1 221 ALA n 1 222 TYR n 1 223 SER n 1 224 PHE n 1 225 GLN n 1 226 GLU n 1 227 THR n 1 228 ALA n 1 229 PHE n 1 230 ALA n 1 231 ALA n 1 232 LEU n 1 233 VAL n 1 234 GLU n 1 235 VAL n 1 236 THR n 1 237 GLU n 1 238 ARG n 1 239 ALA n 1 240 VAL n 1 241 ALA n 1 242 HIS n 1 243 THR n 1 244 GLU n 1 245 LYS n 1 246 ASP n 1 247 GLU n 1 248 VAL n 1 249 VAL n 1 250 LEU n 1 251 VAL n 1 252 GLY n 1 253 GLY n 1 254 VAL n 1 255 ALA n 1 256 ALA n 1 257 ASN n 1 258 ASN n 1 259 ARG n 1 260 LEU n 1 261 ARG n 1 262 GLU n 1 263 MET n 1 264 LEU n 1 265 ARG n 1 266 ILE n 1 267 MET n 1 268 THR n 1 269 GLU n 1 270 ASP n 1 271 ARG n 1 272 GLY n 1 273 ILE n 1 274 LYS n 1 275 PHE n 1 276 PHE n 1 277 VAL n 1 278 PRO n 1 279 PRO n 1 280 TYR n 1 281 ASP n 1 282 LEU n 1 283 CYS n 1 284 ARG n 1 285 ASP n 1 286 ASN n 1 287 GLY n 1 288 ALA n 1 289 MET n 1 290 ILE n 1 291 ALA n 1 292 TYR n 1 293 THR n 1 294 GLY n 1 295 LEU n 1 296 ARG n 1 297 MET n 1 298 TYR n 1 299 LYS n 1 300 ALA n 1 301 GLY n 1 302 ILE n 1 303 SER n 1 304 PHE n 1 305 ARG n 1 306 LEU n 1 307 GLU n 1 308 GLU n 1 309 THR n 1 310 ILE n 1 311 VAL n 1 312 LYS n 1 313 GLN n 1 314 LYS n 1 315 PHE n 1 316 ARG n 1 317 THR n 1 318 ASP n 1 319 GLU n 1 320 VAL n 1 321 GLU n 1 322 ILE n 1 323 VAL n 1 324 TRP n 1 325 HIS n 1 326 HIS n 1 327 HIS n 1 328 HIS n 1 329 HIS n 1 330 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'PYROCOCCUS ABYSSI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'ROSETTA (DE3) PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP GCP_PYRAB 1 ? ? Q9UXT7 ? 2 PDB 2IVP 1 ? ? 2IVP ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2IVP A 1 ? 324 ? Q9UXT7 1 ? 324 ? 1 324 2 2 2IVP A 325 ? 330 ? 2IVP 325 ? 330 ? 325 330 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2IVP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_percent_sol 45.17 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 5.6' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.74005 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_wavelength 1.74005 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2IVP _reflns.observed_criterion_sigma_I 1.5 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.00 _reflns.d_resolution_high 2.50 _reflns.number_obs 11607 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.10 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 6.20 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 13.6 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.64 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.47 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.50 _reflns_shell.pdbx_redundancy 13.2 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2IVP _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 10219 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.00 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 94.3 _refine.ls_R_factor_obs 0.221 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.218 _refine.ls_R_factor_R_free 0.277 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 516 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.927 _refine.correlation_coeff_Fo_to_Fc_free 0.890 _refine.B_iso_mean 33.52 _refine.aniso_B[1][1] 0.60000 _refine.aniso_B[2][2] -1.43000 _refine.aniso_B[3][3] 0.83000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 2.914 _refine.pdbx_overall_ESU_R_Free 0.358 _refine.overall_SU_ML 0.241 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 10.860 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2499 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2531 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 10.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.008 0.022 ? 2576 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.113 1.991 ? 3484 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.220 5.000 ? 324 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.116 23.113 ? 106 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.771 15.000 ? 449 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.877 15.000 ? 20 'X-RAY DIFFRACTION' ? r_chiral_restr 0.065 0.200 ? 395 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.020 ? 1900 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.183 0.200 ? 1090 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.298 0.200 ? 1768 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.133 0.200 ? 58 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.148 0.200 ? 27 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.159 0.200 ? 1 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.452 1.500 ? 1660 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 0.780 2.000 ? 2563 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 1.035 3.000 ? 1042 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 1.737 4.500 ? 921 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.56 _refine_ls_shell.number_reflns_R_work 720 _refine_ls_shell.R_factor_R_work 0.3260 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.3750 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 33 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2IVP _struct.title 'Structure of UP1 protein' _struct.pdbx_descriptor 'O-SIALOGLYCOPROTEIN ENDOPEPTIDASE (E.C.3.4.24.57)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2IVP _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;UP1 KEOPS COMPLEX, FE/ZN DEPENDENT NUCLEOTIDE PHOSPHATASE, METALLOPROTEASE, HYPOTHETICAL PROTEIN, ZINC, PROTEASE, HYDROLASE, METAL-BINDING ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 39 ? GLY A 63 ? HIS A 39 GLY A 63 1 ? 25 HELX_P HELX_P2 2 LEU A 80 ? TYR A 98 ? LEU A 80 TYR A 98 1 ? 19 HELX_P HELX_P3 3 HIS A 107 ? ILE A 114 ? HIS A 107 ILE A 114 1 ? 8 HELX_P HELX_P4 4 THR A 115 ? GLY A 119 ? THR A 115 GLY A 119 5 ? 5 HELX_P HELX_P5 5 GLY A 153 ? LEU A 165 ? GLY A 153 LEU A 165 1 ? 13 HELX_P HELX_P6 6 PRO A 170 ? LYS A 181 ? PRO A 170 LYS A 181 1 ? 12 HELX_P HELX_P7 7 PHE A 199 ? GLY A 213 ? PHE A 199 GLY A 213 1 ? 15 HELX_P HELX_P8 8 ARG A 216 ? GLU A 244 ? ARG A 216 GLU A 244 1 ? 29 HELX_P HELX_P9 9 GLY A 252 ? ALA A 256 ? GLY A 252 ALA A 256 5 ? 5 HELX_P HELX_P10 10 ASN A 257 ? ARG A 271 ? ASN A 257 ARG A 271 1 ? 15 HELX_P HELX_P11 11 PRO A 279 ? CYS A 283 ? PRO A 279 CYS A 283 5 ? 5 HELX_P HELX_P12 12 ASN A 286 ? ALA A 300 ? ASN A 286 ALA A 300 1 ? 15 HELX_P HELX_P13 13 ARG A 305 ? ILE A 310 ? ARG A 305 ILE A 310 5 ? 6 HELX_P HELX_P14 14 ARG A 316 ? VAL A 320 ? ARG A 316 VAL A 320 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B FE2 . FE ? ? ? 1_555 A TYR 127 OH ? ? A FE2 1326 A TYR 127 1_555 ? ? ? ? ? ? ? 2.354 ? metalc2 metalc ? ? B FE2 . FE ? ? ? 1_555 A ASP 285 OD1 ? ? A FE2 1326 A ASP 285 1_555 ? ? ? ? ? ? ? 2.293 ? metalc3 metalc ? ? B FE2 . FE ? ? ? 1_555 C ATP . O1G ? ? A FE2 1326 A ATP 1327 1_555 ? ? ? ? ? ? ? 2.472 ? metalc4 metalc ? ? B FE2 . FE ? ? ? 1_555 A HIS 107 NE2 ? ? A FE2 1326 A HIS 107 1_555 ? ? ? ? ? ? ? 2.245 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 77 A . ? GLY 77 A PRO 78 A ? PRO 78 A 1 -3.90 2 PHE 169 A . ? PHE 169 A PRO 170 A ? PRO 170 A 1 1.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 5 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? parallel AA 4 5 ? parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? parallel AB 4 5 ? parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 23 ? THR A 30 ? VAL A 23 THR A 30 AA 2 THR A 12 ? VAL A 18 ? THR A 12 VAL A 18 AA 3 ALA A 3 ? GLU A 7 ? ALA A 3 GLU A 7 AA 4 VAL A 71 ? GLY A 77 ? VAL A 71 GLY A 77 AA 5 ILE A 102 ? ASN A 106 ? ILE A 102 ASN A 106 AB 1 TYR A 143 ? GLU A 148 ? TYR A 143 GLU A 148 AB 2 THR A 133 ? LEU A 138 ? THR A 133 LEU A 138 AB 3 VAL A 124 ? VAL A 128 ? VAL A 124 VAL A 128 AB 4 GLU A 247 ? VAL A 251 ? GLU A 247 VAL A 251 AB 5 LYS A 274 ? PHE A 276 ? LYS A 274 PHE A 276 AC 1 VAL A 192 ? LYS A 193 ? VAL A 192 LYS A 193 AC 2 ASP A 196 ? LEU A 197 ? ASP A 196 LEU A 197 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ASP A 29 ? N ASP A 29 O LEU A 13 ? O LEU A 13 AA 2 3 N VAL A 18 ? N VAL A 18 O ALA A 3 ? O ALA A 3 AA 3 4 N LEU A 4 ? N LEU A 4 O VAL A 71 ? O VAL A 71 AA 4 5 N PHE A 74 ? N PHE A 74 O VAL A 103 ? O VAL A 103 AB 1 2 N PHE A 146 ? N PHE A 146 O VAL A 135 ? O VAL A 135 AB 2 3 N LEU A 136 ? N LEU A 136 O GLY A 125 ? O GLY A 125 AB 3 4 N VAL A 124 ? N VAL A 124 O GLU A 247 ? O GLU A 247 AB 4 5 N VAL A 248 ? N VAL A 248 O LYS A 274 ? O LYS A 274 AC 1 2 N LYS A 193 ? N LYS A 193 O ASP A 196 ? O ASP A 196 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE2 A1326' AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ATP A1327' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 107 ? HIS A 107 . ? 1_555 ? 2 AC1 5 HIS A 111 ? HIS A 111 . ? 1_555 ? 3 AC1 5 TYR A 127 ? TYR A 127 . ? 1_555 ? 4 AC1 5 ASP A 285 ? ASP A 285 . ? 1_555 ? 5 AC1 5 ATP C . ? ATP A 1327 . ? 1_555 ? 6 AC2 18 THR A 9 ? THR A 9 . ? 1_555 ? 7 AC2 18 HIS A 107 ? HIS A 107 . ? 1_555 ? 8 AC2 18 TYR A 127 ? TYR A 127 . ? 1_555 ? 9 AC2 18 SER A 129 ? SER A 129 . ? 1_555 ? 10 AC2 18 GLY A 130 ? GLY A 130 . ? 1_555 ? 11 AC2 18 GLY A 131 ? GLY A 131 . ? 1_555 ? 12 AC2 18 ASN A 132 ? ASN A 132 . ? 1_555 ? 13 AC2 18 GLY A 155 ? GLY A 155 . ? 1_555 ? 14 AC2 18 ASP A 159 ? ASP A 159 . ? 1_555 ? 15 AC2 18 GLY A 172 ? GLY A 172 . ? 1_555 ? 16 AC2 18 GLU A 176 ? GLU A 176 . ? 1_555 ? 17 AC2 18 GLY A 253 ? GLY A 253 . ? 1_555 ? 18 AC2 18 ALA A 256 ? ALA A 256 . ? 1_555 ? 19 AC2 18 ASN A 257 ? ASN A 257 . ? 1_555 ? 20 AC2 18 TYR A 280 ? TYR A 280 . ? 1_555 ? 21 AC2 18 ARG A 284 ? ARG A 284 . ? 1_555 ? 22 AC2 18 ASP A 285 ? ASP A 285 . ? 1_555 ? 23 AC2 18 FE2 B . ? FE2 A 1326 . ? 1_555 ? # _database_PDB_matrix.entry_id 2IVP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2IVP _atom_sites.fract_transf_matrix[1][1] 0.016211 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014303 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013458 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 MET 195 195 195 MET MET A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 PHE 199 199 199 PHE PHE A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 TYR 210 210 210 TYR TYR A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 TYR 222 222 222 TYR TYR A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 GLN 225 225 225 GLN GLN A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 HIS 242 242 242 HIS HIS A . n A 1 243 THR 243 243 243 THR THR A . n A 1 244 GLU 244 244 244 GLU GLU A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 ASN 257 257 257 ASN ASN A . n A 1 258 ASN 258 258 258 ASN ASN A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 ARG 261 261 261 ARG ARG A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 MET 263 263 263 MET MET A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 ARG 265 265 265 ARG ARG A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 MET 267 267 267 MET MET A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 ARG 271 271 271 ARG ARG A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 PHE 275 275 275 PHE PHE A . n A 1 276 PHE 276 276 276 PHE PHE A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 PRO 278 278 278 PRO PRO A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 TYR 280 280 280 TYR TYR A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 CYS 283 283 283 CYS CYS A . n A 1 284 ARG 284 284 284 ARG ARG A . n A 1 285 ASP 285 285 285 ASP ASP A . n A 1 286 ASN 286 286 286 ASN ASN A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 ALA 288 288 288 ALA ALA A . n A 1 289 MET 289 289 289 MET MET A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 TYR 292 292 292 TYR TYR A . n A 1 293 THR 293 293 293 THR THR A . n A 1 294 GLY 294 294 294 GLY GLY A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 MET 297 297 297 MET MET A . n A 1 298 TYR 298 298 298 TYR TYR A . n A 1 299 LYS 299 299 299 LYS LYS A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 GLY 301 301 301 GLY GLY A . n A 1 302 ILE 302 302 302 ILE ILE A . n A 1 303 SER 303 303 303 SER SER A . n A 1 304 PHE 304 304 304 PHE PHE A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 THR 309 309 309 THR THR A . n A 1 310 ILE 310 310 310 ILE ILE A . n A 1 311 VAL 311 311 311 VAL VAL A . n A 1 312 LYS 312 312 312 LYS LYS A . n A 1 313 GLN 313 313 313 GLN GLN A . n A 1 314 LYS 314 314 314 LYS LYS A . n A 1 315 PHE 315 315 315 PHE PHE A . n A 1 316 ARG 316 316 316 ARG ARG A . n A 1 317 THR 317 317 317 THR THR A . n A 1 318 ASP 318 318 318 ASP ASP A . n A 1 319 GLU 319 319 319 GLU GLU A . n A 1 320 VAL 320 320 320 VAL VAL A . n A 1 321 GLU 321 321 321 GLU GLU A . n A 1 322 ILE 322 322 322 ILE ILE A . n A 1 323 VAL 323 323 323 VAL VAL A . n A 1 324 TRP 324 324 324 TRP TRP A . n A 1 325 HIS 325 325 325 HIS HIS A . n A 1 326 HIS 326 326 ? ? ? A . n A 1 327 HIS 327 327 ? ? ? A . n A 1 328 HIS 328 328 ? ? ? A . n A 1 329 HIS 329 329 ? ? ? A . n A 1 330 HIS 330 330 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 1326 1326 FE2 FE2 A . C 3 ATP 1 1327 1327 ATP ATP A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OH ? A TYR 127 ? A TYR 127 ? 1_555 FE ? B FE2 . ? A FE2 1326 ? 1_555 OD1 ? A ASP 285 ? A ASP 285 ? 1_555 175.5 ? 2 OH ? A TYR 127 ? A TYR 127 ? 1_555 FE ? B FE2 . ? A FE2 1326 ? 1_555 O1G ? C ATP . ? A ATP 1327 ? 1_555 69.4 ? 3 OD1 ? A ASP 285 ? A ASP 285 ? 1_555 FE ? B FE2 . ? A FE2 1326 ? 1_555 O1G ? C ATP . ? A ATP 1327 ? 1_555 109.8 ? 4 OH ? A TYR 127 ? A TYR 127 ? 1_555 FE ? B FE2 . ? A FE2 1326 ? 1_555 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 90.5 ? 5 OD1 ? A ASP 285 ? A ASP 285 ? 1_555 FE ? B FE2 . ? A FE2 1326 ? 1_555 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 86.5 ? 6 O1G ? C ATP . ? A ATP 1327 ? 1_555 FE ? B FE2 . ? A FE2 1326 ? 1_555 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 123.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-31 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 10 ? ? -128.46 -131.56 2 1 SER A 19 ? ? -102.66 -168.33 3 1 ASP A 122 ? ? -153.34 80.92 4 1 ASP A 151 ? ? -134.00 -89.33 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 326 ? A HIS 326 2 1 Y 1 A HIS 327 ? A HIS 327 3 1 Y 1 A HIS 328 ? A HIS 328 4 1 Y 1 A HIS 329 ? A HIS 329 5 1 Y 1 A HIS 330 ? A HIS 330 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 "ADENOSINE-5'-TRIPHOSPHATE" ATP #