data_2IYH # _entry.id 2IYH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2IYH PDBE EBI-29178 WWPDB D_1290029178 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2007-04-03 _pdbx_database_PDB_obs_spr.pdb_id 2UW2 _pdbx_database_PDB_obs_spr.replace_pdb_id 2IYH _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 2IYH _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-07-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Welin, M.' 1 'Stenmark, P.' 2 'Arrowsmith, C.' 3 'Berglund, H.' 4 'Busam, R.' 5 'Collins, R.' 6 'Edwards, A.' 7 'Ehn, M.' 8 'Flodin, S.' 9 'Flores, A.' 10 'Graslund, S.' 11 'Hammarstrom, M.' 12 'Hallberg, B.M.' 13 'Holmberg Schiavone, L.' 14 'Hogbom, M.' 15 'Kotenyova, T.' 16 'Magnusdottir, A.' 17 'Nilsson-Ehle, P.' 18 'Nyman, T.' 19 'Ogg, D.' 20 'Persson, C.' 21 'Sagemark, J.' 22 'Sundstrom, M.' 23 'Uppenberg, J.' 24 'Thorsell, A.G.' 25 'Van Den Berg, S.' 26 'Wallden, K.' 27 'Weigelt, J.' 28 'Nordlund, P.' 29 # _citation.id primary _citation.title 'Crystal Structure of Human Ribonucleotide Reductase Subunit R2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Welin, M.' 1 primary 'Stenmark, P.' 2 primary 'Arrowsmith, C.' 3 primary 'Berglund, H.' 4 primary 'Busam, R.' 5 primary 'Collins, R.' 6 primary 'Edwards, A.' 7 primary 'Ehn, M.' 8 primary 'Flodin, S.' 9 primary 'Flores, A.' 10 primary 'Graslund, S.' 11 primary 'Hammarstrom, M.' 12 primary 'Hallberg, B.M.' 13 primary 'Holmberg Schiavone, L.' 14 primary 'Hogbom, M.' 15 primary 'Kotenyova, T.' 16 primary 'Magnusdottir, A.' 17 primary 'Nilsson-Ehle, P.' 18 primary 'Nyman, T.' 19 primary 'Ogg, D.' 20 primary 'Persson, C.' 21 primary 'Sagemark, J.' 22 primary 'Sundstrom, M.' 23 primary 'Uppenberg, J.' 24 primary 'Thorsell, A.G.' 25 primary 'Van Den Berg, S.' 26 primary 'Wallden, K.' 27 primary 'Weigelt, J.' 28 primary 'Nordlund, P.' 29 # _cell.entry_id 2IYH _cell.length_a 76.120 _cell.length_b 110.700 _cell.length_c 94.420 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2IYH _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE M2 SUBUNIT' 41180.973 1 1.17.4.1 ? 'RESIDUES 60-389' ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RIBONUCLEOTIDE REDUCTASE SMALL SUBUNIT, RIBBONUCLEOTIDE REDUCTASE SMALL CHAIN, RIBONUCLEOTIDE REDUCTASE SUBUNIT R2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSMTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHW ESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNA IETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLM FKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLE GKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHW ESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNA IETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLM FKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLE GKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MET n 1 24 THR n 1 25 LYS n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 PRO n 1 30 GLY n 1 31 VAL n 1 32 GLU n 1 33 ASP n 1 34 GLU n 1 35 PRO n 1 36 LEU n 1 37 LEU n 1 38 ARG n 1 39 GLU n 1 40 ASN n 1 41 PRO n 1 42 ARG n 1 43 ARG n 1 44 PHE n 1 45 VAL n 1 46 ILE n 1 47 PHE n 1 48 PRO n 1 49 ILE n 1 50 GLU n 1 51 TYR n 1 52 HIS n 1 53 ASP n 1 54 ILE n 1 55 TRP n 1 56 GLN n 1 57 MET n 1 58 TYR n 1 59 LYS n 1 60 LYS n 1 61 ALA n 1 62 GLU n 1 63 ALA n 1 64 SER n 1 65 PHE n 1 66 TRP n 1 67 THR n 1 68 ALA n 1 69 GLU n 1 70 GLU n 1 71 VAL n 1 72 ASP n 1 73 LEU n 1 74 SER n 1 75 LYS n 1 76 ASP n 1 77 ILE n 1 78 GLN n 1 79 HIS n 1 80 TRP n 1 81 GLU n 1 82 SER n 1 83 LEU n 1 84 LYS n 1 85 PRO n 1 86 GLU n 1 87 GLU n 1 88 ARG n 1 89 TYR n 1 90 PHE n 1 91 ILE n 1 92 SER n 1 93 HIS n 1 94 VAL n 1 95 LEU n 1 96 ALA n 1 97 PHE n 1 98 PHE n 1 99 ALA n 1 100 ALA n 1 101 SER n 1 102 ASP n 1 103 GLY n 1 104 ILE n 1 105 VAL n 1 106 ASN n 1 107 GLU n 1 108 ASN n 1 109 LEU n 1 110 VAL n 1 111 GLU n 1 112 ARG n 1 113 PHE n 1 114 SER n 1 115 GLN n 1 116 GLU n 1 117 VAL n 1 118 GLN n 1 119 ILE n 1 120 THR n 1 121 GLU n 1 122 ALA n 1 123 ARG n 1 124 CYS n 1 125 PHE n 1 126 TYR n 1 127 GLY n 1 128 PHE n 1 129 GLN n 1 130 ILE n 1 131 ALA n 1 132 MET n 1 133 GLU n 1 134 ASN n 1 135 ILE n 1 136 HIS n 1 137 SER n 1 138 GLU n 1 139 MET n 1 140 TYR n 1 141 SER n 1 142 LEU n 1 143 LEU n 1 144 ILE n 1 145 ASP n 1 146 THR n 1 147 TYR n 1 148 ILE n 1 149 LYS n 1 150 ASP n 1 151 PRO n 1 152 LYS n 1 153 GLU n 1 154 ARG n 1 155 GLU n 1 156 PHE n 1 157 LEU n 1 158 PHE n 1 159 ASN n 1 160 ALA n 1 161 ILE n 1 162 GLU n 1 163 THR n 1 164 MET n 1 165 PRO n 1 166 CYS n 1 167 VAL n 1 168 LYS n 1 169 LYS n 1 170 LYS n 1 171 ALA n 1 172 ASP n 1 173 TRP n 1 174 ALA n 1 175 LEU n 1 176 ARG n 1 177 TRP n 1 178 ILE n 1 179 GLY n 1 180 ASP n 1 181 LYS n 1 182 GLU n 1 183 ALA n 1 184 THR n 1 185 TYR n 1 186 GLY n 1 187 GLU n 1 188 ARG n 1 189 VAL n 1 190 VAL n 1 191 ALA n 1 192 PHE n 1 193 ALA n 1 194 ALA n 1 195 VAL n 1 196 GLU n 1 197 GLY n 1 198 ILE n 1 199 PHE n 1 200 PHE n 1 201 SER n 1 202 GLY n 1 203 SER n 1 204 PHE n 1 205 ALA n 1 206 SER n 1 207 ILE n 1 208 PHE n 1 209 TRP n 1 210 LEU n 1 211 LYS n 1 212 LYS n 1 213 ARG n 1 214 GLY n 1 215 LEU n 1 216 MET n 1 217 PRO n 1 218 GLY n 1 219 LEU n 1 220 THR n 1 221 PHE n 1 222 SER n 1 223 ASN n 1 224 GLU n 1 225 LEU n 1 226 ILE n 1 227 SER n 1 228 ARG n 1 229 ASP n 1 230 GLU n 1 231 GLY n 1 232 LEU n 1 233 HIS n 1 234 CYS n 1 235 ASP n 1 236 PHE n 1 237 ALA n 1 238 CYS n 1 239 LEU n 1 240 MET n 1 241 PHE n 1 242 LYS n 1 243 HIS n 1 244 LEU n 1 245 VAL n 1 246 HIS n 1 247 LYS n 1 248 PRO n 1 249 SER n 1 250 GLU n 1 251 GLU n 1 252 ARG n 1 253 VAL n 1 254 ARG n 1 255 GLU n 1 256 ILE n 1 257 ILE n 1 258 ILE n 1 259 ASN n 1 260 ALA n 1 261 VAL n 1 262 ARG n 1 263 ILE n 1 264 GLU n 1 265 GLN n 1 266 GLU n 1 267 PHE n 1 268 LEU n 1 269 THR n 1 270 GLU n 1 271 ALA n 1 272 LEU n 1 273 PRO n 1 274 VAL n 1 275 LYS n 1 276 LEU n 1 277 ILE n 1 278 GLY n 1 279 MET n 1 280 ASN n 1 281 CYS n 1 282 THR n 1 283 LEU n 1 284 MET n 1 285 LYS n 1 286 GLN n 1 287 TYR n 1 288 ILE n 1 289 GLU n 1 290 PHE n 1 291 VAL n 1 292 ALA n 1 293 ASP n 1 294 ARG n 1 295 LEU n 1 296 MET n 1 297 LEU n 1 298 GLU n 1 299 LEU n 1 300 GLY n 1 301 PHE n 1 302 SER n 1 303 LYS n 1 304 VAL n 1 305 PHE n 1 306 ARG n 1 307 VAL n 1 308 GLU n 1 309 ASN n 1 310 PRO n 1 311 PHE n 1 312 ASP n 1 313 PHE n 1 314 MET n 1 315 GLU n 1 316 ASN n 1 317 ILE n 1 318 SER n 1 319 LEU n 1 320 GLU n 1 321 GLY n 1 322 LYS n 1 323 THR n 1 324 ASN n 1 325 PHE n 1 326 PHE n 1 327 GLU n 1 328 LYS n 1 329 ARG n 1 330 VAL n 1 331 GLY n 1 332 GLU n 1 333 TYR n 1 334 GLN n 1 335 ARG n 1 336 MET n 1 337 GLY n 1 338 VAL n 1 339 MET n 1 340 SER n 1 341 SER n 1 342 PRO n 1 343 THR n 1 344 GLU n 1 345 ASN n 1 346 SER n 1 347 PHE n 1 348 THR n 1 349 LEU n 1 350 ASP n 1 351 ALA n 1 352 ASP n 1 353 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PNIC-BSA4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2IYH 1 ? ? 2IYH ? 2 UNP RIR2_HUMAN 1 ? ? P31350 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2IYH A 1 ? 23 ? 2IYH 37 ? 59 ? 37 59 2 2 2IYH A 24 ? 353 ? P31350 60 ? 389 ? 60 389 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2IYH _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_percent_sol 50 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1M BISTRIS PH 5.5, 0.12M AMAC, 11% PEG 10K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2006-04-21 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator DIAMOND _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-EH1' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-EH1 _diffrn_source.pdbx_wavelength 0.934 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2IYH _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.00 _reflns.d_resolution_high 2.70 _reflns.number_obs 10697 _reflns.number_all ? _reflns.percent_possible_obs 94.9 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.05 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.6 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.80 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.43 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.80 _reflns_shell.pdbx_redundancy 3.68 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2IYH _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 9082 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.45 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 94.67 _refine.ls_R_factor_obs 0.23844 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23520 _refine.ls_R_factor_R_free 0.29950 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 480 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.912 _refine.correlation_coeff_Fo_to_Fc_free 0.851 _refine.B_iso_mean 41.134 _refine.aniso_B[1][1] -0.19 _refine.aniso_B[2][2] -0.27 _refine.aniso_B[3][3] 0.46 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. RESIDUES 78-81 AND 194-199 ARE DISORDERED.' _refine.pdbx_starting_model 'PDB ENTRY 1XSM' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.435 _refine.overall_SU_ML 0.338 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 36.030 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2270 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 2277 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 19.45 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.010 0.022 ? 2327 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.275 1.947 ? 3136 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.877 5.000 ? 272 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.831 23.898 ? 118 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 19.723 15.000 ? 417 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.990 15.000 ? 14 'X-RAY DIFFRACTION' ? r_chiral_restr 0.092 0.200 ? 332 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 1765 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.222 0.200 ? 1081 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.314 0.200 ? 1605 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.357 0.200 ? 73 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.232 0.200 ? 26 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.254 0.200 ? 7 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.533 1.500 ? 1407 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 0.948 2.000 ? 2211 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 1.102 3.000 ? 1051 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 1.740 4.500 ? 925 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.800 _refine_ls_shell.d_res_low 2.871 _refine_ls_shell.number_reflns_R_work 678 _refine_ls_shell.R_factor_R_work 0.279 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.400 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2IYH _struct.title 'Crystal structure of human ribonucleotide reductase subunit R2' _struct.pdbx_descriptor 'RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE M2 SUBUNIT (E.C.1.17.4.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2IYH _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text ;SMALL SUBUNIT RIBONUCLEOTIDE REDUCTASE, OXIDOREDUCTASE, DNA REPLICATION, R2, IRON, DIIRON, RADICAL, R2 SUBUNIT, METAL-BINDING, RIBONUCLEOTIDE REDUCTASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 51 ? SER A 64 ? TYR A 87 SER A 100 1 ? 14 HELX_P HELX_P2 2 THR A 67 ? VAL A 71 ? THR A 103 VAL A 107 5 ? 5 HELX_P HELX_P3 3 ASP A 76 ? GLU A 81 ? ASP A 112 GLU A 117 1 ? 6 HELX_P HELX_P4 4 LYS A 84 ? PHE A 98 ? LYS A 120 PHE A 134 1 ? 15 HELX_P HELX_P5 5 PHE A 98 ? ARG A 112 ? PHE A 134 ARG A 148 1 ? 15 HELX_P HELX_P6 6 ARG A 112 ? VAL A 117 ? ARG A 148 VAL A 153 1 ? 6 HELX_P HELX_P7 7 ILE A 119 ? ILE A 148 ? ILE A 155 ILE A 184 1 ? 30 HELX_P HELX_P8 8 ASP A 150 ? GLU A 155 ? ASP A 186 GLU A 191 1 ? 6 HELX_P HELX_P9 9 LEU A 175 ? ASP A 180 ? LEU A 211 ASP A 216 1 ? 6 HELX_P HELX_P10 10 THR A 184 ? ILE A 198 ? THR A 220 ILE A 234 1 ? 15 HELX_P HELX_P11 11 PHE A 200 ? LYS A 212 ? PHE A 236 LYS A 248 1 ? 13 HELX_P HELX_P12 12 MET A 216 ? HIS A 243 ? MET A 252 HIS A 279 1 ? 28 HELX_P HELX_P13 13 SER A 249 ? GLU A 270 ? SER A 285 GLU A 306 1 ? 22 HELX_P HELX_P14 14 PRO A 273 ? GLY A 278 ? PRO A 309 GLY A 314 5 ? 6 HELX_P HELX_P15 15 ASN A 280 ? LEU A 299 ? ASN A 316 LEU A 335 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B FE . FE ? ? ? 1_555 A GLU 196 OE2 ? ? A FE 1351 A GLU 232 1_555 ? ? ? ? ? ? ? 2.333 ? metalc2 metalc ? ? B FE . FE ? ? ? 1_555 A GLU 230 OE2 ? ? A FE 1351 A GLU 266 1_555 ? ? ? ? ? ? ? 2.252 ? metalc3 metalc ? ? B FE . FE ? ? ? 1_555 A HIS 233 ND1 ? ? A FE 1351 A HIS 269 1_555 ? ? ? ? ? ? ? 2.255 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code ? _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'FE BINDING SITE FOR CHAIN A' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLU A 133 ? GLU A 169 . ? 1_555 ? 2 AC1 5 GLU A 196 ? GLU A 232 . ? 1_555 ? 3 AC1 5 GLU A 230 ? GLU A 266 . ? 1_555 ? 4 AC1 5 HIS A 233 ? HIS A 269 . ? 1_555 ? 5 AC1 5 HOH C . ? HOH Z 4 . ? 1_555 ? # _database_PDB_matrix.entry_id 2IYH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2IYH _atom_sites.fract_transf_matrix[1][1] 0.013137 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009033 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010591 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 37 ? ? ? A . n A 1 2 HIS 2 38 ? ? ? A . n A 1 3 HIS 3 39 ? ? ? A . n A 1 4 HIS 4 40 ? ? ? A . n A 1 5 HIS 5 41 ? ? ? A . n A 1 6 HIS 6 42 ? ? ? A . n A 1 7 HIS 7 43 ? ? ? A . n A 1 8 SER 8 44 ? ? ? A . n A 1 9 SER 9 45 ? ? ? A . n A 1 10 GLY 10 46 ? ? ? A . n A 1 11 VAL 11 47 ? ? ? A . n A 1 12 ASP 12 48 ? ? ? A . n A 1 13 LEU 13 49 ? ? ? A . n A 1 14 GLY 14 50 ? ? ? A . n A 1 15 THR 15 51 ? ? ? A . n A 1 16 GLU 16 52 ? ? ? A . n A 1 17 ASN 17 53 ? ? ? A . n A 1 18 LEU 18 54 ? ? ? A . n A 1 19 TYR 19 55 ? ? ? A . n A 1 20 PHE 20 56 ? ? ? A . n A 1 21 GLN 21 57 ? ? ? A . n A 1 22 SER 22 58 ? ? ? A . n A 1 23 MET 23 59 ? ? ? A . n A 1 24 THR 24 60 ? ? ? A . n A 1 25 LYS 25 61 ? ? ? A . n A 1 26 ALA 26 62 ? ? ? A . n A 1 27 ALA 27 63 ? ? ? A . n A 1 28 ALA 28 64 ? ? ? A . n A 1 29 PRO 29 65 ? ? ? A . n A 1 30 GLY 30 66 66 GLY GLY A . n A 1 31 VAL 31 67 67 VAL VAL A . n A 1 32 GLU 32 68 68 GLU GLU A . n A 1 33 ASP 33 69 69 ASP ASP A . n A 1 34 GLU 34 70 70 GLU GLU A . n A 1 35 PRO 35 71 71 PRO PRO A . n A 1 36 LEU 36 72 72 LEU LEU A . n A 1 37 LEU 37 73 73 LEU LEU A . n A 1 38 ARG 38 74 74 ARG ARG A . n A 1 39 GLU 39 75 75 GLU GLU A . n A 1 40 ASN 40 76 76 ASN ASN A . n A 1 41 PRO 41 77 77 PRO PRO A . n A 1 42 ARG 42 78 ? ? ? A . n A 1 43 ARG 43 79 ? ? ? A . n A 1 44 PHE 44 80 ? ? ? A . n A 1 45 VAL 45 81 ? ? ? A . n A 1 46 ILE 46 82 82 ILE ILE A . n A 1 47 PHE 47 83 83 PHE PHE A . n A 1 48 PRO 48 84 84 PRO PRO A . n A 1 49 ILE 49 85 85 ILE ILE A . n A 1 50 GLU 50 86 86 GLU GLU A . n A 1 51 TYR 51 87 87 TYR TYR A . n A 1 52 HIS 52 88 88 HIS HIS A . n A 1 53 ASP 53 89 89 ASP ASP A . n A 1 54 ILE 54 90 90 ILE ILE A . n A 1 55 TRP 55 91 91 TRP TRP A . n A 1 56 GLN 56 92 92 GLN GLN A . n A 1 57 MET 57 93 93 MET MET A . n A 1 58 TYR 58 94 94 TYR TYR A . n A 1 59 LYS 59 95 95 LYS LYS A . n A 1 60 LYS 60 96 96 LYS LYS A . n A 1 61 ALA 61 97 97 ALA ALA A . n A 1 62 GLU 62 98 98 GLU GLU A . n A 1 63 ALA 63 99 99 ALA ALA A . n A 1 64 SER 64 100 100 SER SER A . n A 1 65 PHE 65 101 101 PHE PHE A . n A 1 66 TRP 66 102 102 TRP TRP A . n A 1 67 THR 67 103 103 THR THR A . n A 1 68 ALA 68 104 104 ALA ALA A . n A 1 69 GLU 69 105 105 GLU GLU A . n A 1 70 GLU 70 106 106 GLU GLU A . n A 1 71 VAL 71 107 107 VAL VAL A . n A 1 72 ASP 72 108 108 ASP ASP A . n A 1 73 LEU 73 109 109 LEU LEU A . n A 1 74 SER 74 110 110 SER SER A . n A 1 75 LYS 75 111 111 LYS LYS A . n A 1 76 ASP 76 112 112 ASP ASP A . n A 1 77 ILE 77 113 113 ILE ILE A . n A 1 78 GLN 78 114 114 GLN GLN A . n A 1 79 HIS 79 115 115 HIS HIS A . n A 1 80 TRP 80 116 116 TRP TRP A . n A 1 81 GLU 81 117 117 GLU GLU A . n A 1 82 SER 82 118 118 SER SER A . n A 1 83 LEU 83 119 119 LEU LEU A . n A 1 84 LYS 84 120 120 LYS LYS A . n A 1 85 PRO 85 121 121 PRO PRO A . n A 1 86 GLU 86 122 122 GLU GLU A . n A 1 87 GLU 87 123 123 GLU GLU A . n A 1 88 ARG 88 124 124 ARG ARG A . n A 1 89 TYR 89 125 125 TYR TYR A . n A 1 90 PHE 90 126 126 PHE PHE A . n A 1 91 ILE 91 127 127 ILE ILE A . n A 1 92 SER 92 128 128 SER SER A . n A 1 93 HIS 93 129 129 HIS HIS A . n A 1 94 VAL 94 130 130 VAL VAL A . n A 1 95 LEU 95 131 131 LEU LEU A . n A 1 96 ALA 96 132 132 ALA ALA A . n A 1 97 PHE 97 133 133 PHE PHE A . n A 1 98 PHE 98 134 134 PHE PHE A . n A 1 99 ALA 99 135 135 ALA ALA A . n A 1 100 ALA 100 136 136 ALA ALA A . n A 1 101 SER 101 137 137 SER SER A . n A 1 102 ASP 102 138 138 ASP ASP A . n A 1 103 GLY 103 139 139 GLY GLY A . n A 1 104 ILE 104 140 140 ILE ILE A . n A 1 105 VAL 105 141 141 VAL VAL A . n A 1 106 ASN 106 142 142 ASN ASN A . n A 1 107 GLU 107 143 143 GLU GLU A . n A 1 108 ASN 108 144 144 ASN ASN A . n A 1 109 LEU 109 145 145 LEU LEU A . n A 1 110 VAL 110 146 146 VAL VAL A . n A 1 111 GLU 111 147 147 GLU GLU A . n A 1 112 ARG 112 148 148 ARG ARG A . n A 1 113 PHE 113 149 149 PHE PHE A . n A 1 114 SER 114 150 150 SER SER A . n A 1 115 GLN 115 151 151 GLN GLN A . n A 1 116 GLU 116 152 152 GLU GLU A . n A 1 117 VAL 117 153 153 VAL VAL A . n A 1 118 GLN 118 154 154 GLN GLN A . n A 1 119 ILE 119 155 155 ILE ILE A . n A 1 120 THR 120 156 156 THR THR A . n A 1 121 GLU 121 157 157 GLU GLU A . n A 1 122 ALA 122 158 158 ALA ALA A . n A 1 123 ARG 123 159 159 ARG ARG A . n A 1 124 CYS 124 160 160 CYS CYS A . n A 1 125 PHE 125 161 161 PHE PHE A . n A 1 126 TYR 126 162 162 TYR TYR A . n A 1 127 GLY 127 163 163 GLY GLY A . n A 1 128 PHE 128 164 164 PHE PHE A . n A 1 129 GLN 129 165 165 GLN GLN A . n A 1 130 ILE 130 166 166 ILE ILE A . n A 1 131 ALA 131 167 167 ALA ALA A . n A 1 132 MET 132 168 168 MET MET A . n A 1 133 GLU 133 169 169 GLU GLU A . n A 1 134 ASN 134 170 170 ASN ASN A . n A 1 135 ILE 135 171 171 ILE ILE A . n A 1 136 HIS 136 172 172 HIS HIS A . n A 1 137 SER 137 173 173 SER SER A . n A 1 138 GLU 138 174 174 GLU GLU A . n A 1 139 MET 139 175 175 MET MET A . n A 1 140 TYR 140 176 176 TYR TYR A . n A 1 141 SER 141 177 177 SER SER A . n A 1 142 LEU 142 178 178 LEU LEU A . n A 1 143 LEU 143 179 179 LEU LEU A . n A 1 144 ILE 144 180 180 ILE ILE A . n A 1 145 ASP 145 181 181 ASP ASP A . n A 1 146 THR 146 182 182 THR THR A . n A 1 147 TYR 147 183 183 TYR TYR A . n A 1 148 ILE 148 184 184 ILE ILE A . n A 1 149 LYS 149 185 185 LYS LYS A . n A 1 150 ASP 150 186 186 ASP ASP A . n A 1 151 PRO 151 187 187 PRO PRO A . n A 1 152 LYS 152 188 188 LYS LYS A . n A 1 153 GLU 153 189 189 GLU GLU A . n A 1 154 ARG 154 190 190 ARG ARG A . n A 1 155 GLU 155 191 191 GLU GLU A . n A 1 156 PHE 156 192 192 PHE PHE A . n A 1 157 LEU 157 193 193 LEU LEU A . n A 1 158 PHE 158 194 ? ? ? A . n A 1 159 ASN 159 195 ? ? ? A . n A 1 160 ALA 160 196 ? ? ? A . n A 1 161 ILE 161 197 ? ? ? A . n A 1 162 GLU 162 198 ? ? ? A . n A 1 163 THR 163 199 ? ? ? A . n A 1 164 MET 164 200 200 MET MET A . n A 1 165 PRO 165 201 201 PRO PRO A . n A 1 166 CYS 166 202 202 CYS CYS A . n A 1 167 VAL 167 203 203 VAL VAL A . n A 1 168 LYS 168 204 204 LYS LYS A . n A 1 169 LYS 169 205 205 LYS LYS A . n A 1 170 LYS 170 206 206 LYS LYS A . n A 1 171 ALA 171 207 207 ALA ALA A . n A 1 172 ASP 172 208 208 ASP ASP A . n A 1 173 TRP 173 209 209 TRP TRP A . n A 1 174 ALA 174 210 210 ALA ALA A . n A 1 175 LEU 175 211 211 LEU LEU A . n A 1 176 ARG 176 212 212 ARG ARG A . n A 1 177 TRP 177 213 213 TRP TRP A . n A 1 178 ILE 178 214 214 ILE ILE A . n A 1 179 GLY 179 215 215 GLY GLY A . n A 1 180 ASP 180 216 216 ASP ASP A . n A 1 181 LYS 181 217 217 LYS LYS A . n A 1 182 GLU 182 218 218 GLU GLU A . n A 1 183 ALA 183 219 219 ALA ALA A . n A 1 184 THR 184 220 220 THR THR A . n A 1 185 TYR 185 221 221 TYR TYR A . n A 1 186 GLY 186 222 222 GLY GLY A . n A 1 187 GLU 187 223 223 GLU GLU A . n A 1 188 ARG 188 224 224 ARG ARG A . n A 1 189 VAL 189 225 225 VAL VAL A . n A 1 190 VAL 190 226 226 VAL VAL A . n A 1 191 ALA 191 227 227 ALA ALA A . n A 1 192 PHE 192 228 228 PHE PHE A . n A 1 193 ALA 193 229 229 ALA ALA A . n A 1 194 ALA 194 230 230 ALA ALA A . n A 1 195 VAL 195 231 231 VAL VAL A . n A 1 196 GLU 196 232 232 GLU GLU A . n A 1 197 GLY 197 233 233 GLY GLY A . n A 1 198 ILE 198 234 234 ILE ILE A . n A 1 199 PHE 199 235 235 PHE PHE A . n A 1 200 PHE 200 236 236 PHE PHE A . n A 1 201 SER 201 237 237 SER SER A . n A 1 202 GLY 202 238 238 GLY GLY A . n A 1 203 SER 203 239 239 SER SER A . n A 1 204 PHE 204 240 240 PHE PHE A . n A 1 205 ALA 205 241 241 ALA ALA A . n A 1 206 SER 206 242 242 SER SER A . n A 1 207 ILE 207 243 243 ILE ILE A . n A 1 208 PHE 208 244 244 PHE PHE A . n A 1 209 TRP 209 245 245 TRP TRP A . n A 1 210 LEU 210 246 246 LEU LEU A . n A 1 211 LYS 211 247 247 LYS LYS A . n A 1 212 LYS 212 248 248 LYS LYS A . n A 1 213 ARG 213 249 249 ARG ARG A . n A 1 214 GLY 214 250 250 GLY GLY A . n A 1 215 LEU 215 251 251 LEU LEU A . n A 1 216 MET 216 252 252 MET MET A . n A 1 217 PRO 217 253 253 PRO PRO A . n A 1 218 GLY 218 254 254 GLY GLY A . n A 1 219 LEU 219 255 255 LEU LEU A . n A 1 220 THR 220 256 256 THR THR A . n A 1 221 PHE 221 257 257 PHE PHE A . n A 1 222 SER 222 258 258 SER SER A . n A 1 223 ASN 223 259 259 ASN ASN A . n A 1 224 GLU 224 260 260 GLU GLU A . n A 1 225 LEU 225 261 261 LEU LEU A . n A 1 226 ILE 226 262 262 ILE ILE A . n A 1 227 SER 227 263 263 SER SER A . n A 1 228 ARG 228 264 264 ARG ARG A . n A 1 229 ASP 229 265 265 ASP ASP A . n A 1 230 GLU 230 266 266 GLU GLU A . n A 1 231 GLY 231 267 267 GLY GLY A . n A 1 232 LEU 232 268 268 LEU LEU A . n A 1 233 HIS 233 269 269 HIS HIS A . n A 1 234 CYS 234 270 270 CYS CYS A . n A 1 235 ASP 235 271 271 ASP ASP A . n A 1 236 PHE 236 272 272 PHE PHE A . n A 1 237 ALA 237 273 273 ALA ALA A . n A 1 238 CYS 238 274 274 CYS CYS A . n A 1 239 LEU 239 275 275 LEU LEU A . n A 1 240 MET 240 276 276 MET MET A . n A 1 241 PHE 241 277 277 PHE PHE A . n A 1 242 LYS 242 278 278 LYS LYS A . n A 1 243 HIS 243 279 279 HIS HIS A . n A 1 244 LEU 244 280 280 LEU LEU A . n A 1 245 VAL 245 281 281 VAL VAL A . n A 1 246 HIS 246 282 282 HIS HIS A . n A 1 247 LYS 247 283 283 LYS LYS A . n A 1 248 PRO 248 284 284 PRO PRO A . n A 1 249 SER 249 285 285 SER SER A . n A 1 250 GLU 250 286 286 GLU GLU A . n A 1 251 GLU 251 287 287 GLU GLU A . n A 1 252 ARG 252 288 288 ARG ARG A . n A 1 253 VAL 253 289 289 VAL VAL A . n A 1 254 ARG 254 290 290 ARG ARG A . n A 1 255 GLU 255 291 291 GLU GLU A . n A 1 256 ILE 256 292 292 ILE ILE A . n A 1 257 ILE 257 293 293 ILE ILE A . n A 1 258 ILE 258 294 294 ILE ILE A . n A 1 259 ASN 259 295 295 ASN ASN A . n A 1 260 ALA 260 296 296 ALA ALA A . n A 1 261 VAL 261 297 297 VAL VAL A . n A 1 262 ARG 262 298 298 ARG ARG A . n A 1 263 ILE 263 299 299 ILE ILE A . n A 1 264 GLU 264 300 300 GLU GLU A . n A 1 265 GLN 265 301 301 GLN GLN A . n A 1 266 GLU 266 302 302 GLU GLU A . n A 1 267 PHE 267 303 303 PHE PHE A . n A 1 268 LEU 268 304 304 LEU LEU A . n A 1 269 THR 269 305 305 THR THR A . n A 1 270 GLU 270 306 306 GLU GLU A . n A 1 271 ALA 271 307 307 ALA ALA A . n A 1 272 LEU 272 308 308 LEU LEU A . n A 1 273 PRO 273 309 309 PRO PRO A . n A 1 274 VAL 274 310 310 VAL VAL A . n A 1 275 LYS 275 311 311 LYS LYS A . n A 1 276 LEU 276 312 312 LEU LEU A . n A 1 277 ILE 277 313 313 ILE ILE A . n A 1 278 GLY 278 314 314 GLY GLY A . n A 1 279 MET 279 315 315 MET MET A . n A 1 280 ASN 280 316 316 ASN ASN A . n A 1 281 CYS 281 317 317 CYS CYS A . n A 1 282 THR 282 318 318 THR THR A . n A 1 283 LEU 283 319 319 LEU LEU A . n A 1 284 MET 284 320 320 MET MET A . n A 1 285 LYS 285 321 321 LYS LYS A . n A 1 286 GLN 286 322 322 GLN GLN A . n A 1 287 TYR 287 323 323 TYR TYR A . n A 1 288 ILE 288 324 324 ILE ILE A . n A 1 289 GLU 289 325 325 GLU GLU A . n A 1 290 PHE 290 326 326 PHE PHE A . n A 1 291 VAL 291 327 327 VAL VAL A . n A 1 292 ALA 292 328 328 ALA ALA A . n A 1 293 ASP 293 329 329 ASP ASP A . n A 1 294 ARG 294 330 330 ARG ARG A . n A 1 295 LEU 295 331 331 LEU LEU A . n A 1 296 MET 296 332 332 MET MET A . n A 1 297 LEU 297 333 333 LEU LEU A . n A 1 298 GLU 298 334 334 GLU GLU A . n A 1 299 LEU 299 335 335 LEU LEU A . n A 1 300 GLY 300 336 336 GLY GLY A . n A 1 301 PHE 301 337 337 PHE PHE A . n A 1 302 SER 302 338 338 SER SER A . n A 1 303 LYS 303 339 339 LYS LYS A . n A 1 304 VAL 304 340 340 VAL VAL A . n A 1 305 PHE 305 341 341 PHE PHE A . n A 1 306 ARG 306 342 342 ARG ARG A . n A 1 307 VAL 307 343 343 VAL VAL A . n A 1 308 GLU 308 344 344 GLU GLU A . n A 1 309 ASN 309 345 345 ASN ASN A . n A 1 310 PRO 310 346 346 PRO PRO A . n A 1 311 PHE 311 347 347 PHE PHE A . n A 1 312 ASP 312 348 348 ASP ASP A . n A 1 313 PHE 313 349 349 PHE PHE A . n A 1 314 MET 314 350 350 MET MET A . n A 1 315 GLU 315 351 ? ? ? A . n A 1 316 ASN 316 352 ? ? ? A . n A 1 317 ILE 317 353 ? ? ? A . n A 1 318 SER 318 354 ? ? ? A . n A 1 319 LEU 319 355 ? ? ? A . n A 1 320 GLU 320 356 ? ? ? A . n A 1 321 GLY 321 357 ? ? ? A . n A 1 322 LYS 322 358 ? ? ? A . n A 1 323 THR 323 359 ? ? ? A . n A 1 324 ASN 324 360 ? ? ? A . n A 1 325 PHE 325 361 ? ? ? A . n A 1 326 PHE 326 362 ? ? ? A . n A 1 327 GLU 327 363 ? ? ? A . n A 1 328 LYS 328 364 ? ? ? A . n A 1 329 ARG 329 365 ? ? ? A . n A 1 330 VAL 330 366 ? ? ? A . n A 1 331 GLY 331 367 ? ? ? A . n A 1 332 GLU 332 368 ? ? ? A . n A 1 333 TYR 333 369 ? ? ? A . n A 1 334 GLN 334 370 ? ? ? A . n A 1 335 ARG 335 371 ? ? ? A . n A 1 336 MET 336 372 ? ? ? A . n A 1 337 GLY 337 373 ? ? ? A . n A 1 338 VAL 338 374 ? ? ? A . n A 1 339 MET 339 375 ? ? ? A . n A 1 340 SER 340 376 ? ? ? A . n A 1 341 SER 341 377 ? ? ? A . n A 1 342 PRO 342 378 ? ? ? A . n A 1 343 THR 343 379 ? ? ? A . n A 1 344 GLU 344 380 ? ? ? A . n A 1 345 ASN 345 381 ? ? ? A . n A 1 346 SER 346 382 ? ? ? A . n A 1 347 PHE 347 383 ? ? ? A . n A 1 348 THR 348 384 ? ? ? A . n A 1 349 LEU 349 385 ? ? ? A . n A 1 350 ASP 350 386 ? ? ? A . n A 1 351 ALA 351 387 ? ? ? A . n A 1 352 ASP 352 388 ? ? ? A . n A 1 353 PHE 353 389 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 1351 1351 FE FE A . C 3 HOH 1 1 1 HOH HOH Z . C 3 HOH 2 2 2 HOH HOH Z . C 3 HOH 3 3 3 HOH HOH Z . C 3 HOH 4 4 4 HOH HOH Z . C 3 HOH 5 5 5 HOH HOH Z . C 3 HOH 6 6 6 HOH HOH Z . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 196 ? A GLU 232 ? 1_555 FE ? B FE . ? A FE 1351 ? 1_555 OE2 ? A GLU 230 ? A GLU 266 ? 1_555 129.4 ? 2 OE2 ? A GLU 196 ? A GLU 232 ? 1_555 FE ? B FE . ? A FE 1351 ? 1_555 ND1 ? A HIS 233 ? A HIS 269 ? 1_555 83.2 ? 3 OE2 ? A GLU 230 ? A GLU 266 ? 1_555 FE ? B FE . ? A FE 1351 ? 1_555 ND1 ? A HIS 233 ? A HIS 269 ? 1_555 98.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-07-20 2 'Structure model' 1 1 2007-04-03 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 9.2895 _pdbx_refine_tls.origin_y 17.1456 _pdbx_refine_tls.origin_z -2.9722 _pdbx_refine_tls.T[1][1] -0.0139 _pdbx_refine_tls.T[2][2] 0.0003 _pdbx_refine_tls.T[3][3] -0.0333 _pdbx_refine_tls.T[1][2] -0.0686 _pdbx_refine_tls.T[1][3] 0.0093 _pdbx_refine_tls.T[2][3] 0.0267 _pdbx_refine_tls.L[1][1] 1.4236 _pdbx_refine_tls.L[2][2] 2.6538 _pdbx_refine_tls.L[3][3] 3.5017 _pdbx_refine_tls.L[1][2] -0.5825 _pdbx_refine_tls.L[1][3] 1.2611 _pdbx_refine_tls.L[2][3] -1.0725 _pdbx_refine_tls.S[1][1] 0.0335 _pdbx_refine_tls.S[1][2] -0.3157 _pdbx_refine_tls.S[1][3] 0.0370 _pdbx_refine_tls.S[2][1] 0.4659 _pdbx_refine_tls.S[2][2] -0.1820 _pdbx_refine_tls.S[2][3] -0.0084 _pdbx_refine_tls.S[3][1] -0.0472 _pdbx_refine_tls.S[3][2] -0.2414 _pdbx_refine_tls.S[3][3] 0.1485 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 66 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 350 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 XDS 'data reduction' . ? 2 XSCALE 'data scaling' . ? 3 MOLREP phasing . ? 4 # _pdbx_entry_details.entry_id 2IYH _pdbx_entry_details.compound_details ;PROVIDES THE PRECURSORS NECESSARY FOR DNA SYNTHESIS. CATALYZES THE BIOSYNTHESIS OF DEOXYRIBONUCLEOTIDES FROM THE CORRESPONDING RIBONUCLEOTIDES. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;FOR METAL ATOM FE FE A1351 THE COORDINATION ANGLES ARE: 1 GLU 232A OE2 2 GLU 266A OE2 129.4 3 HIS 269A ND1 83.2 98.4 1 2 ; _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 152 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 224 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NE2 A GLN 151 ? ? 1_555 NE2 A GLN 151 ? ? 4_555 1.66 2 1 OE1 A GLU 117 ? ? 1_555 NH2 A ARG 342 ? ? 6_555 2.16 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A THR 103 ? ? N A ALA 104 ? ? 1.192 1.336 -0.144 0.023 Y 2 1 C A GLU 106 ? ? N A VAL 107 ? ? 1.077 1.336 -0.259 0.023 Y 3 1 C A VAL 107 ? ? N A ASP 108 ? ? 1.170 1.336 -0.166 0.023 Y 4 1 C A ALA 210 ? ? N A LEU 211 ? ? 1.488 1.336 0.152 0.023 Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 73 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 73 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 73 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 101.10 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation -14.20 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 84 ? ? -65.10 87.42 2 1 ALA A 136 ? ? -77.48 33.36 3 1 SER A 137 ? ? -121.64 -65.06 4 1 ARG A 148 ? ? -132.53 -73.36 5 1 LYS A 204 ? ? -73.16 38.37 6 1 ILE A 234 ? ? -92.48 -61.90 7 1 MET A 252 ? ? 48.06 75.26 8 1 GLU A 306 ? ? -133.45 -65.25 9 1 LEU A 308 ? ? -168.38 74.95 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ALA _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 210 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -14.67 # loop_ _pdbx_validate_polymer_linkage.id _pdbx_validate_polymer_linkage.PDB_model_num _pdbx_validate_polymer_linkage.auth_atom_id_1 _pdbx_validate_polymer_linkage.auth_asym_id_1 _pdbx_validate_polymer_linkage.auth_comp_id_1 _pdbx_validate_polymer_linkage.auth_seq_id_1 _pdbx_validate_polymer_linkage.PDB_ins_code_1 _pdbx_validate_polymer_linkage.label_alt_id_1 _pdbx_validate_polymer_linkage.auth_atom_id_2 _pdbx_validate_polymer_linkage.auth_asym_id_2 _pdbx_validate_polymer_linkage.auth_comp_id_2 _pdbx_validate_polymer_linkage.auth_seq_id_2 _pdbx_validate_polymer_linkage.PDB_ins_code_2 _pdbx_validate_polymer_linkage.label_alt_id_2 _pdbx_validate_polymer_linkage.dist 1 1 C A THR 103 ? ? N A ALA 104 ? ? 1.19 2 1 C A GLU 106 ? ? N A VAL 107 ? ? 1.08 3 1 C A VAL 107 ? ? N A ASP 108 ? ? 1.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 37 ? A MET 1 2 1 Y 1 A HIS 38 ? A HIS 2 3 1 Y 1 A HIS 39 ? A HIS 3 4 1 Y 1 A HIS 40 ? A HIS 4 5 1 Y 1 A HIS 41 ? A HIS 5 6 1 Y 1 A HIS 42 ? A HIS 6 7 1 Y 1 A HIS 43 ? A HIS 7 8 1 Y 1 A SER 44 ? A SER 8 9 1 Y 1 A SER 45 ? A SER 9 10 1 Y 1 A GLY 46 ? A GLY 10 11 1 Y 1 A VAL 47 ? A VAL 11 12 1 Y 1 A ASP 48 ? A ASP 12 13 1 Y 1 A LEU 49 ? A LEU 13 14 1 Y 1 A GLY 50 ? A GLY 14 15 1 Y 1 A THR 51 ? A THR 15 16 1 Y 1 A GLU 52 ? A GLU 16 17 1 Y 1 A ASN 53 ? A ASN 17 18 1 Y 1 A LEU 54 ? A LEU 18 19 1 Y 1 A TYR 55 ? A TYR 19 20 1 Y 1 A PHE 56 ? A PHE 20 21 1 Y 1 A GLN 57 ? A GLN 21 22 1 Y 1 A SER 58 ? A SER 22 23 1 Y 1 A MET 59 ? A MET 23 24 1 Y 1 A THR 60 ? A THR 24 25 1 Y 1 A LYS 61 ? A LYS 25 26 1 Y 1 A ALA 62 ? A ALA 26 27 1 Y 1 A ALA 63 ? A ALA 27 28 1 Y 1 A ALA 64 ? A ALA 28 29 1 Y 1 A PRO 65 ? A PRO 29 30 1 Y 1 A ARG 78 ? A ARG 42 31 1 Y 1 A ARG 79 ? A ARG 43 32 1 Y 1 A PHE 80 ? A PHE 44 33 1 Y 1 A VAL 81 ? A VAL 45 34 1 Y 1 A PHE 194 ? A PHE 158 35 1 Y 1 A ASN 195 ? A ASN 159 36 1 Y 1 A ALA 196 ? A ALA 160 37 1 Y 1 A ILE 197 ? A ILE 161 38 1 Y 1 A GLU 198 ? A GLU 162 39 1 Y 1 A THR 199 ? A THR 163 40 1 Y 1 A GLU 351 ? A GLU 315 41 1 Y 1 A ASN 352 ? A ASN 316 42 1 Y 1 A ILE 353 ? A ILE 317 43 1 Y 1 A SER 354 ? A SER 318 44 1 Y 1 A LEU 355 ? A LEU 319 45 1 Y 1 A GLU 356 ? A GLU 320 46 1 Y 1 A GLY 357 ? A GLY 321 47 1 Y 1 A LYS 358 ? A LYS 322 48 1 Y 1 A THR 359 ? A THR 323 49 1 Y 1 A ASN 360 ? A ASN 324 50 1 Y 1 A PHE 361 ? A PHE 325 51 1 Y 1 A PHE 362 ? A PHE 326 52 1 Y 1 A GLU 363 ? A GLU 327 53 1 Y 1 A LYS 364 ? A LYS 328 54 1 Y 1 A ARG 365 ? A ARG 329 55 1 Y 1 A VAL 366 ? A VAL 330 56 1 Y 1 A GLY 367 ? A GLY 331 57 1 Y 1 A GLU 368 ? A GLU 332 58 1 Y 1 A TYR 369 ? A TYR 333 59 1 Y 1 A GLN 370 ? A GLN 334 60 1 Y 1 A ARG 371 ? A ARG 335 61 1 Y 1 A MET 372 ? A MET 336 62 1 Y 1 A GLY 373 ? A GLY 337 63 1 Y 1 A VAL 374 ? A VAL 338 64 1 Y 1 A MET 375 ? A MET 339 65 1 Y 1 A SER 376 ? A SER 340 66 1 Y 1 A SER 377 ? A SER 341 67 1 Y 1 A PRO 378 ? A PRO 342 68 1 Y 1 A THR 379 ? A THR 343 69 1 Y 1 A GLU 380 ? A GLU 344 70 1 Y 1 A ASN 381 ? A ASN 345 71 1 Y 1 A SER 382 ? A SER 346 72 1 Y 1 A PHE 383 ? A PHE 347 73 1 Y 1 A THR 384 ? A THR 348 74 1 Y 1 A LEU 385 ? A LEU 349 75 1 Y 1 A ASP 386 ? A ASP 350 76 1 Y 1 A ALA 387 ? A ALA 351 77 1 Y 1 A ASP 388 ? A ASP 352 78 1 Y 1 A PHE 389 ? A PHE 353 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 water HOH #