data_2IZ3 # _entry.id 2IZ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2IZ3 pdb_00002iz3 10.2210/pdb2iz3/pdb PDBE EBI-29486 ? ? WWPDB D_1290029486 ? ? BMRB 15037 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2IZ4 unspecified 'SOLUTION STRUCTURE OF HUMAN BETA- MICROSEMINOPROTEIN' BMRB 15037 unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2IZ3 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-07-24 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ghasriani, H.' 1 'Teilum, K.' 2 'Johnsson, Y.' 3 'Fernlund, P.' 4 'Drakenberg, T.' 5 # _citation.id primary _citation.title 'Solution Structure of Human and Porcine Beta-Microseminoprotein' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 362 _citation.page_first 502 _citation.page_last ? _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16930619 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2006.07.029 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ghasriani, H.' 1 ? primary 'Teilum, K.' 2 ? primary 'Johnsson, Y.' 3 ? primary 'Fernlund, P.' 4 ? primary 'Drakenberg, T.' 5 ? # _cell.entry_id 2IZ3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2IZ3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description BETA-MICROSEMINOPROTEIN _entity.formula_weight 10955.430 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 21-114' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;PROSTATE SECRETED SEMINAL PLASMA PROTEIN, PROSTATE SECRETORY PROTEIN PSP94, PSP-94, IGBF, PN44, IMMUNOGLOBULIN-BINDING FACTOR, SEMINAL PLASMA BETA-INHIBIN ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGGSCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIV VEKKDPKKTCSVSEWII ; _entity_poly.pdbx_seq_one_letter_code_can ;GGGSCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIV VEKKDPKKTCSVSEWII ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 GLY n 1 4 SER n 1 5 CYS n 1 6 TYR n 1 7 PHE n 1 8 ILE n 1 9 PRO n 1 10 ASN n 1 11 GLU n 1 12 GLY n 1 13 VAL n 1 14 PRO n 1 15 GLY n 1 16 ASP n 1 17 SER n 1 18 THR n 1 19 ARG n 1 20 LYS n 1 21 CYS n 1 22 MET n 1 23 ASP n 1 24 LEU n 1 25 LYS n 1 26 GLY n 1 27 ASN n 1 28 LYS n 1 29 HIS n 1 30 PRO n 1 31 ILE n 1 32 ASN n 1 33 SER n 1 34 GLU n 1 35 TRP n 1 36 GLN n 1 37 THR n 1 38 ASP n 1 39 ASN n 1 40 CYS n 1 41 GLU n 1 42 THR n 1 43 CYS n 1 44 THR n 1 45 CYS n 1 46 TYR n 1 47 GLU n 1 48 THR n 1 49 GLU n 1 50 ILE n 1 51 SER n 1 52 CYS n 1 53 CYS n 1 54 THR n 1 55 LEU n 1 56 VAL n 1 57 SER n 1 58 THR n 1 59 PRO n 1 60 VAL n 1 61 GLY n 1 62 TYR n 1 63 ASP n 1 64 LYS n 1 65 ASP n 1 66 ASN n 1 67 CYS n 1 68 GLN n 1 69 ARG n 1 70 ILE n 1 71 PHE n 1 72 LYS n 1 73 LYS n 1 74 GLU n 1 75 ASP n 1 76 CYS n 1 77 LYS n 1 78 TYR n 1 79 ILE n 1 80 VAL n 1 81 VAL n 1 82 GLU n 1 83 LYS n 1 84 LYS n 1 85 ASP n 1 86 PRO n 1 87 LYS n 1 88 LYS n 1 89 THR n 1 90 CYS n 1 91 SER n 1 92 VAL n 1 93 SER n 1 94 GLU n 1 95 TRP n 1 96 ILE n 1 97 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PROSTATE _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain NOVABLUE _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET30 XA/LIC' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2IZ3 1 ? ? 2IZ3 ? 2 UNP MSMB_HUMAN 1 ? ? P08118 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2IZ3 A 1 ? 3 ? 2IZ3 -2 ? 0 ? -2 0 2 2 2IZ3 A 4 ? 97 ? P08118 21 ? 114 ? 1 94 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type NOESY _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310.0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 2IZ3 _pdbx_nmr_refine.method ANNEALING _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2IZ3 _pdbx_nmr_details.text 'NOE-RESTRAINTS WERE COLLECTED FROM 3D-15N-EDITED NOESY, 3D-1EC-EDITED NOESY AND 2D NOESY SPECTRA' # _pdbx_nmr_ensemble.entry_id 2IZ3 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOW ENERGY AND NO VIOLATIONS > 0.5 A' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Xplor-NIH ? CLORE 1 'structure solution' Xplor-NIH ? ? 2 # _exptl.entry_id 2IZ3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2IZ3 _struct.title 'Solution structure of human beta-microseminoprotein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2IZ3 _struct_keywords.pdbx_keywords INHIBITOR _struct_keywords.text 'POLYMORPHISM, ALTERNATIVE SPLICING, INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 73 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 76 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 70 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 73 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 2 A CYS 50 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf2 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 18 A CYS 42 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf3 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 76 SG ? ? A CYS 37 A CYS 73 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf4 disulf ? ? A CYS 43 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 40 A CYS 49 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf5 disulf ? ? A CYS 67 SG ? ? ? 1_555 A CYS 90 SG ? ? A CYS 64 A CYS 87 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 4 ? AB ? 2 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 CYS A 5 ? PRO A 9 ? CYS A 2 PRO A 6 AA 2 GLU A 49 ? THR A 54 ? GLU A 46 THR A 51 AA 3 GLU A 41 ? TYR A 46 ? GLU A 38 TYR A 43 AA 4 GLU A 34 ? THR A 37 ? GLU A 31 THR A 34 AB 1 THR A 58 ? VAL A 60 ? THR A 55 VAL A 57 AB 2 GLU A 94 ? ILE A 96 ? GLU A 91 ILE A 93 AC 1 CYS A 67 ? LYS A 72 ? CYS A 64 LYS A 69 AC 2 LYS A 77 ? GLU A 82 ? LYS A 74 GLU A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 8 ? N ILE A 5 O ILE A 50 ? O ILE A 47 AA 2 3 N CYS A 53 ? N CYS A 50 O THR A 42 ? O THR A 39 AA 3 4 N CYS A 43 ? N CYS A 40 O TRP A 35 ? O TRP A 32 AB 1 2 N VAL A 60 ? N VAL A 57 O GLU A 94 ? O GLU A 91 AC 1 2 N LYS A 72 ? N LYS A 69 O LYS A 77 ? O LYS A 74 # _database_PDB_matrix.entry_id 2IZ3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2IZ3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 GLY 3 0 ? ? ? A . n A 1 4 SER 4 1 1 SER SER A . n A 1 5 CYS 5 2 2 CYS CYS A . n A 1 6 TYR 6 3 3 TYR TYR A . n A 1 7 PHE 7 4 4 PHE PHE A . n A 1 8 ILE 8 5 5 ILE ILE A . n A 1 9 PRO 9 6 6 PRO PRO A . n A 1 10 ASN 10 7 7 ASN ASN A . n A 1 11 GLU 11 8 8 GLU GLU A . n A 1 12 GLY 12 9 9 GLY GLY A . n A 1 13 VAL 13 10 10 VAL VAL A . n A 1 14 PRO 14 11 11 PRO PRO A . n A 1 15 GLY 15 12 12 GLY GLY A . n A 1 16 ASP 16 13 13 ASP ASP A . n A 1 17 SER 17 14 14 SER SER A . n A 1 18 THR 18 15 15 THR THR A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 LYS 20 17 17 LYS LYS A . n A 1 21 CYS 21 18 18 CYS CYS A . n A 1 22 MET 22 19 19 MET MET A . n A 1 23 ASP 23 20 20 ASP ASP A . n A 1 24 LEU 24 21 21 LEU LEU A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 GLY 26 23 23 GLY GLY A . n A 1 27 ASN 27 24 24 ASN ASN A . n A 1 28 LYS 28 25 25 LYS LYS A . n A 1 29 HIS 29 26 26 HIS HIS A . n A 1 30 PRO 30 27 27 PRO PRO A . n A 1 31 ILE 31 28 28 ILE ILE A . n A 1 32 ASN 32 29 29 ASN ASN A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 TRP 35 32 32 TRP TRP A . n A 1 36 GLN 36 33 33 GLN GLN A . n A 1 37 THR 37 34 34 THR THR A . n A 1 38 ASP 38 35 35 ASP ASP A . n A 1 39 ASN 39 36 36 ASN ASN A . n A 1 40 CYS 40 37 37 CYS CYS A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 THR 42 39 39 THR THR A . n A 1 43 CYS 43 40 40 CYS CYS A . n A 1 44 THR 44 41 41 THR THR A . n A 1 45 CYS 45 42 42 CYS CYS A . n A 1 46 TYR 46 43 43 TYR TYR A . n A 1 47 GLU 47 44 44 GLU GLU A . n A 1 48 THR 48 45 45 THR THR A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 SER 51 48 48 SER SER A . n A 1 52 CYS 52 49 49 CYS CYS A . n A 1 53 CYS 53 50 50 CYS CYS A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 VAL 56 53 53 VAL VAL A . n A 1 57 SER 57 54 54 SER SER A . n A 1 58 THR 58 55 55 THR THR A . n A 1 59 PRO 59 56 56 PRO PRO A . n A 1 60 VAL 60 57 57 VAL VAL A . n A 1 61 GLY 61 58 58 GLY GLY A . n A 1 62 TYR 62 59 59 TYR TYR A . n A 1 63 ASP 63 60 60 ASP ASP A . n A 1 64 LYS 64 61 61 LYS LYS A . n A 1 65 ASP 65 62 62 ASP ASP A . n A 1 66 ASN 66 63 63 ASN ASN A . n A 1 67 CYS 67 64 64 CYS CYS A . n A 1 68 GLN 68 65 65 GLN GLN A . n A 1 69 ARG 69 66 66 ARG ARG A . n A 1 70 ILE 70 67 67 ILE ILE A . n A 1 71 PHE 71 68 68 PHE PHE A . n A 1 72 LYS 72 69 69 LYS LYS A . n A 1 73 LYS 73 70 70 LYS LYS A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 ASP 75 72 72 ASP ASP A . n A 1 76 CYS 76 73 73 CYS CYS A . n A 1 77 LYS 77 74 74 LYS LYS A . n A 1 78 TYR 78 75 75 TYR TYR A . n A 1 79 ILE 79 76 76 ILE ILE A . n A 1 80 VAL 80 77 77 VAL VAL A . n A 1 81 VAL 81 78 78 VAL VAL A . n A 1 82 GLU 82 79 79 GLU GLU A . n A 1 83 LYS 83 80 80 LYS LYS A . n A 1 84 LYS 84 81 81 LYS LYS A . n A 1 85 ASP 85 82 82 ASP ASP A . n A 1 86 PRO 86 83 83 PRO PRO A . n A 1 87 LYS 87 84 84 LYS LYS A . n A 1 88 LYS 88 85 85 LYS LYS A . n A 1 89 THR 89 86 86 THR THR A . n A 1 90 CYS 90 87 87 CYS CYS A . n A 1 91 SER 91 88 88 SER SER A . n A 1 92 VAL 92 89 89 VAL VAL A . n A 1 93 SER 93 90 90 SER SER A . n A 1 94 GLU 94 91 91 GLU GLU A . n A 1 95 TRP 95 92 92 TRP TRP A . n A 1 96 ILE 96 93 93 ILE ILE A . n A 1 97 ILE 97 94 94 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-24 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-01-15 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' Other 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_nmr_software 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_database_status.status_code_mr' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A PRO 6 ? ? H A GLU 8 ? ? 1.46 2 3 OD1 A ASP 20 ? ? H A LEU 21 ? ? 1.59 3 4 O A THR 51 ? ? H A VAL 53 ? ? 1.39 4 4 OD1 A ASP 20 ? ? H A LEU 21 ? ? 1.57 5 5 O A PRO 6 ? ? H A GLY 9 ? ? 1.45 6 6 O A PRO 6 ? ? H A GLY 9 ? ? 1.45 7 7 O A PRO 6 ? ? H A GLU 8 ? ? 1.49 8 7 OD1 A ASP 20 ? ? H A LEU 21 ? ? 1.55 9 9 OG1 A THR 51 ? ? H A LEU 52 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 7 ? ? -75.61 34.87 2 1 SER A 14 ? ? -139.09 -47.00 3 1 ARG A 16 ? ? 65.43 -8.94 4 1 LYS A 17 ? ? -94.42 -86.00 5 1 CYS A 18 ? ? -163.41 92.60 6 1 CYS A 37 ? ? 172.74 22.29 7 1 CYS A 73 ? ? 36.23 64.88 8 2 GLU A 8 ? ? -102.15 72.65 9 2 SER A 14 ? ? 43.28 -113.34 10 2 CYS A 18 ? ? 37.15 62.56 11 2 ASN A 29 ? ? 78.12 -4.27 12 2 ASN A 36 ? ? -107.26 -125.90 13 2 THR A 45 ? ? -140.95 -40.40 14 2 CYS A 73 ? ? 37.08 67.79 15 3 CYS A 2 ? ? 41.94 100.19 16 3 ASN A 7 ? ? -59.42 62.32 17 3 GLU A 8 ? ? -161.06 -30.39 18 3 SER A 14 ? ? -165.54 -60.29 19 3 ARG A 16 ? ? 56.65 85.91 20 3 LYS A 17 ? ? -162.16 14.90 21 3 CYS A 18 ? ? 39.72 82.62 22 3 PRO A 27 ? ? -53.04 178.61 23 3 ASP A 35 ? ? 67.28 -9.61 24 3 ASN A 36 ? ? 89.34 -38.46 25 3 THR A 45 ? ? -140.39 36.18 26 3 ASN A 63 ? ? -103.64 49.18 27 3 CYS A 64 ? ? 163.29 141.36 28 3 CYS A 73 ? ? 37.09 60.96 29 3 PRO A 83 ? ? -55.25 -8.53 30 4 SER A 14 ? ? -147.77 -20.69 31 4 ARG A 16 ? ? 51.07 -165.92 32 4 LYS A 17 ? ? 62.92 -173.61 33 4 CYS A 18 ? ? -102.42 48.47 34 4 PRO A 27 ? ? -48.10 -177.19 35 4 ASP A 35 ? ? 53.99 -82.46 36 4 ASN A 36 ? ? 173.25 117.19 37 4 THR A 45 ? ? -140.38 31.06 38 4 LEU A 52 ? ? 58.53 -38.58 39 4 CYS A 73 ? ? 38.92 64.07 40 5 CYS A 2 ? ? 38.08 96.82 41 5 ASN A 7 ? ? -38.24 -26.46 42 5 ASP A 13 ? ? 53.87 102.14 43 5 SER A 14 ? ? -154.33 -59.03 44 5 LYS A 17 ? ? -150.74 -158.04 45 5 CYS A 18 ? ? -99.13 43.68 46 5 ASN A 63 ? ? -104.35 47.92 47 5 CYS A 64 ? ? 162.16 143.10 48 5 CYS A 73 ? ? 37.20 66.32 49 6 ASN A 7 ? ? -37.93 -27.41 50 6 PRO A 11 ? ? -42.54 87.95 51 6 SER A 14 ? ? -95.46 -64.17 52 6 ARG A 16 ? ? 57.14 -163.72 53 6 LYS A 17 ? ? 64.52 -138.16 54 6 THR A 45 ? ? -141.61 33.53 55 6 CYS A 73 ? ? 36.27 64.22 56 7 CYS A 2 ? ? 33.89 94.32 57 7 ASN A 7 ? ? -62.76 62.47 58 7 GLU A 8 ? ? -161.81 -40.21 59 7 ASP A 13 ? ? -71.70 42.34 60 7 ARG A 16 ? ? 65.34 -6.05 61 7 LYS A 17 ? ? -102.82 -113.56 62 7 PRO A 27 ? ? -48.45 -177.25 63 7 ASN A 29 ? ? 74.59 -4.16 64 7 ASP A 35 ? ? 60.88 177.07 65 7 CYS A 37 ? ? -158.24 75.77 66 7 THR A 45 ? ? -140.34 31.69 67 7 LEU A 52 ? ? 38.98 19.64 68 7 CYS A 73 ? ? 38.86 63.08 69 8 CYS A 2 ? ? 57.35 102.44 70 8 ASN A 7 ? ? -98.24 40.87 71 8 GLU A 8 ? ? -147.44 39.65 72 8 SER A 14 ? ? -146.43 -33.49 73 8 ARG A 16 ? ? 66.03 -9.01 74 8 LYS A 17 ? ? -101.97 -95.06 75 8 ASN A 36 ? ? -179.68 27.71 76 8 ASP A 60 ? ? -65.08 96.68 77 8 CYS A 73 ? ? 38.91 59.03 78 9 CYS A 2 ? ? -179.25 146.22 79 9 PRO A 11 ? ? -42.10 89.07 80 9 SER A 14 ? ? -160.40 24.54 81 9 ARG A 16 ? ? 53.96 -131.38 82 9 LYS A 17 ? ? 43.42 13.91 83 9 CYS A 18 ? ? 33.86 63.69 84 9 PRO A 27 ? ? -55.30 -176.38 85 9 ASN A 29 ? ? 71.54 -1.73 86 9 ASP A 35 ? ? 48.14 170.99 87 9 THR A 45 ? ? -142.61 32.71 88 9 THR A 51 ? ? -58.44 -139.57 89 9 LEU A 52 ? ? -157.62 -29.89 90 9 CYS A 73 ? ? 34.77 66.97 91 10 CYS A 2 ? ? 40.91 96.17 92 10 SER A 14 ? ? -74.46 -87.78 93 10 THR A 15 ? ? -97.56 -69.26 94 10 ARG A 16 ? ? -176.26 -15.12 95 10 LYS A 17 ? ? -76.65 -123.74 96 10 ASN A 29 ? ? 73.29 -4.93 97 10 ASN A 36 ? ? 155.65 -112.47 98 10 CYS A 37 ? ? -154.21 58.24 99 10 THR A 45 ? ? -141.47 37.72 100 10 LEU A 52 ? ? 50.86 0.60 101 10 CYS A 73 ? ? 37.09 63.32 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A GLY -1 ? A GLY 2 3 1 Y 1 A GLY 0 ? A GLY 3 4 2 Y 1 A GLY -2 ? A GLY 1 5 2 Y 1 A GLY -1 ? A GLY 2 6 2 Y 1 A GLY 0 ? A GLY 3 7 3 Y 1 A GLY -2 ? A GLY 1 8 3 Y 1 A GLY -1 ? A GLY 2 9 3 Y 1 A GLY 0 ? A GLY 3 10 4 Y 1 A GLY -2 ? A GLY 1 11 4 Y 1 A GLY -1 ? A GLY 2 12 4 Y 1 A GLY 0 ? A GLY 3 13 5 Y 1 A GLY -2 ? A GLY 1 14 5 Y 1 A GLY -1 ? A GLY 2 15 5 Y 1 A GLY 0 ? A GLY 3 16 6 Y 1 A GLY -2 ? A GLY 1 17 6 Y 1 A GLY -1 ? A GLY 2 18 6 Y 1 A GLY 0 ? A GLY 3 19 7 Y 1 A GLY -2 ? A GLY 1 20 7 Y 1 A GLY -1 ? A GLY 2 21 7 Y 1 A GLY 0 ? A GLY 3 22 8 Y 1 A GLY -2 ? A GLY 1 23 8 Y 1 A GLY -1 ? A GLY 2 24 8 Y 1 A GLY 0 ? A GLY 3 25 9 Y 1 A GLY -2 ? A GLY 1 26 9 Y 1 A GLY -1 ? A GLY 2 27 9 Y 1 A GLY 0 ? A GLY 3 28 10 Y 1 A GLY -2 ? A GLY 1 29 10 Y 1 A GLY -1 ? A GLY 2 30 10 Y 1 A GLY 0 ? A GLY 3 #