data_2J0I # _entry.id 2J0I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2J0I PDBE EBI-29565 WWPDB D_1290029565 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2CDZ _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'CRYSTAL STRUCTURE OF THE HUMAN P21-ACTIVATED KINASE 4 IN COMPLEX WITH CGP74514A' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2J0I _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-08-03 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Debreczeni, J.E.' 1 ? 'Eswaran, J.' 2 ? 'Ugochukwu, E.' 3 ? 'Papagrigoriou, E.' 4 ? 'Turnbull, A.' 5 ? 'von Delft, F.' 6 ? 'Arrowsmith, C.' 7 ? 'Weigelt, J.' 8 ? 'Edwards, A.' 9 ? 'Sundstrom, M.' 10 ? 'Knapp, S.' 11 ? # _citation.id primary _citation.title 'Crystal Structure of the Human P21-Activated Kinase 4' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Debreczeni, J.E.' 1 ? primary 'Eswaran, J.' 2 ? primary 'Ugochukwu, E.' 3 ? primary 'Papagrigoriou, E.' 4 ? primary 'Turnbull, A.' 5 ? primary 'von Delft, F.' 6 ? primary 'Arrowsmith, C.' 7 ? primary 'Weigelt, J.' 8 ? primary 'Edwards, A.' 9 ? primary 'Sundstrom, M.' 10 ? primary 'Knapp, S.' 11 ? # _cell.entry_id 2J0I _cell.length_a 63.514 _cell.length_b 63.514 _cell.length_c 178.478 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2J0I _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SERINE/THREONINE-PROTEIN KINASE PAK 4' 34235.691 1 '2.7.1.37, 2.7.11.1' ? 'KINASE DOMAIN, RESIDUES 291-591' ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 4 ? ? ? ? 3 water nat water 18.015 205 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HUMAN P21-ACTIVATED KINASE 4, PAK-4, P21-ACTIVATED KINASE 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVV IMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILL THDGRVKLSDFGFCAQVSKEVPRRK(SEP)LVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAM KMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVV IMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILL THDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIR DNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 PRO n 1 5 GLN n 1 6 ARG n 1 7 GLU n 1 8 PRO n 1 9 GLN n 1 10 ARG n 1 11 VAL n 1 12 SER n 1 13 HIS n 1 14 GLU n 1 15 GLN n 1 16 PHE n 1 17 ARG n 1 18 ALA n 1 19 ALA n 1 20 LEU n 1 21 GLN n 1 22 LEU n 1 23 VAL n 1 24 VAL n 1 25 ASP n 1 26 PRO n 1 27 GLY n 1 28 ASP n 1 29 PRO n 1 30 ARG n 1 31 SER n 1 32 TYR n 1 33 LEU n 1 34 ASP n 1 35 ASN n 1 36 PHE n 1 37 ILE n 1 38 LYS n 1 39 ILE n 1 40 GLY n 1 41 GLU n 1 42 GLY n 1 43 SER n 1 44 THR n 1 45 GLY n 1 46 ILE n 1 47 VAL n 1 48 CYS n 1 49 ILE n 1 50 ALA n 1 51 THR n 1 52 VAL n 1 53 ARG n 1 54 SER n 1 55 SER n 1 56 GLY n 1 57 LYS n 1 58 LEU n 1 59 VAL n 1 60 ALA n 1 61 VAL n 1 62 LYS n 1 63 LYS n 1 64 MET n 1 65 ASP n 1 66 LEU n 1 67 ARG n 1 68 LYS n 1 69 GLN n 1 70 GLN n 1 71 ARG n 1 72 ARG n 1 73 GLU n 1 74 LEU n 1 75 LEU n 1 76 PHE n 1 77 ASN n 1 78 GLU n 1 79 VAL n 1 80 VAL n 1 81 ILE n 1 82 MET n 1 83 ARG n 1 84 ASP n 1 85 TYR n 1 86 GLN n 1 87 HIS n 1 88 GLU n 1 89 ASN n 1 90 VAL n 1 91 VAL n 1 92 GLU n 1 93 MET n 1 94 TYR n 1 95 ASN n 1 96 SER n 1 97 TYR n 1 98 LEU n 1 99 VAL n 1 100 GLY n 1 101 ASP n 1 102 GLU n 1 103 LEU n 1 104 TRP n 1 105 VAL n 1 106 VAL n 1 107 MET n 1 108 GLU n 1 109 PHE n 1 110 LEU n 1 111 GLU n 1 112 GLY n 1 113 GLY n 1 114 ALA n 1 115 LEU n 1 116 THR n 1 117 ASP n 1 118 ILE n 1 119 VAL n 1 120 THR n 1 121 HIS n 1 122 THR n 1 123 ARG n 1 124 MET n 1 125 ASN n 1 126 GLU n 1 127 GLU n 1 128 GLN n 1 129 ILE n 1 130 ALA n 1 131 ALA n 1 132 VAL n 1 133 CYS n 1 134 LEU n 1 135 ALA n 1 136 VAL n 1 137 LEU n 1 138 GLN n 1 139 ALA n 1 140 LEU n 1 141 SER n 1 142 VAL n 1 143 LEU n 1 144 HIS n 1 145 ALA n 1 146 GLN n 1 147 GLY n 1 148 VAL n 1 149 ILE n 1 150 HIS n 1 151 ARG n 1 152 ASP n 1 153 ILE n 1 154 LYS n 1 155 SER n 1 156 ASP n 1 157 SER n 1 158 ILE n 1 159 LEU n 1 160 LEU n 1 161 THR n 1 162 HIS n 1 163 ASP n 1 164 GLY n 1 165 ARG n 1 166 VAL n 1 167 LYS n 1 168 LEU n 1 169 SER n 1 170 ASP n 1 171 PHE n 1 172 GLY n 1 173 PHE n 1 174 CYS n 1 175 ALA n 1 176 GLN n 1 177 VAL n 1 178 SER n 1 179 LYS n 1 180 GLU n 1 181 VAL n 1 182 PRO n 1 183 ARG n 1 184 ARG n 1 185 LYS n 1 186 SEP n 1 187 LEU n 1 188 VAL n 1 189 GLY n 1 190 THR n 1 191 PRO n 1 192 TYR n 1 193 TRP n 1 194 MET n 1 195 ALA n 1 196 PRO n 1 197 GLU n 1 198 LEU n 1 199 ILE n 1 200 SER n 1 201 ARG n 1 202 LEU n 1 203 PRO n 1 204 TYR n 1 205 GLY n 1 206 PRO n 1 207 GLU n 1 208 VAL n 1 209 ASP n 1 210 ILE n 1 211 TRP n 1 212 SER n 1 213 LEU n 1 214 GLY n 1 215 ILE n 1 216 MET n 1 217 VAL n 1 218 ILE n 1 219 GLU n 1 220 MET n 1 221 VAL n 1 222 ASP n 1 223 GLY n 1 224 GLU n 1 225 PRO n 1 226 PRO n 1 227 TYR n 1 228 PHE n 1 229 ASN n 1 230 GLU n 1 231 PRO n 1 232 PRO n 1 233 LEU n 1 234 LYS n 1 235 ALA n 1 236 MET n 1 237 LYS n 1 238 MET n 1 239 ILE n 1 240 ARG n 1 241 ASP n 1 242 ASN n 1 243 LEU n 1 244 PRO n 1 245 PRO n 1 246 ARG n 1 247 LEU n 1 248 LYS n 1 249 ASN n 1 250 LEU n 1 251 HIS n 1 252 LYS n 1 253 VAL n 1 254 SER n 1 255 PRO n 1 256 SER n 1 257 LEU n 1 258 LYS n 1 259 GLY n 1 260 PHE n 1 261 LEU n 1 262 ASP n 1 263 ARG n 1 264 LEU n 1 265 LEU n 1 266 VAL n 1 267 ARG n 1 268 ASP n 1 269 PRO n 1 270 ALA n 1 271 GLN n 1 272 ARG n 1 273 ALA n 1 274 THR n 1 275 ALA n 1 276 ALA n 1 277 GLU n 1 278 LEU n 1 279 LEU n 1 280 LYS n 1 281 HIS n 1 282 PRO n 1 283 PHE n 1 284 LEU n 1 285 ALA n 1 286 LYS n 1 287 ALA n 1 288 GLY n 1 289 PRO n 1 290 PRO n 1 291 ALA n 1 292 SER n 1 293 ILE n 1 294 VAL n 1 295 PRO n 1 296 LEU n 1 297 MET n 1 298 ARG n 1 299 GLN n 1 300 ASN n 1 301 ARG n 1 302 THR n 1 303 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PGEX-6P-2NDE-XHO _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2J0I 1 ? ? 2J0I ? 2 UNP PAK4_HUMAN 1 ? ? O96013 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2J0I A 1 ? 2 ? 2J0I 289 ? 290 ? 289 290 2 2 2J0I A 3 ? 303 ? O96013 291 ? 591 ? 291 591 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2J0I _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_percent_sol 53.9 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '150 UL SITTING DROPS, 4DEG, 0.2M K3(CIT), 0.1M BIS-TRIS PROPANE PH 6.5, 20% PEG3350, 10% ETHYLENE GLYCOL' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2006-06-16 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI 111' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_wavelength 0.976 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2J0I _reflns.observed_criterion_sigma_I 3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 43.550 _reflns.d_resolution_high 1.600 _reflns.number_obs 49277 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.09000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.3400 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.330 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.70 _reflns_shell.percent_possible_all 99.5 _reflns_shell.Rmerge_I_obs 0.40000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.620 _reflns_shell.pdbx_redundancy 4.20 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2J0I _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 46301 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 43.56 _refine.ls_d_res_high 1.60 _refine.ls_percent_reflns_obs 99.0 _refine.ls_R_factor_obs 0.174 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.172 _refine.ls_R_factor_R_free 0.215 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 2460 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.B_iso_mean 19.95 _refine.aniso_B[1][1] 0.28000 _refine.aniso_B[2][2] 0.28000 _refine.aniso_B[3][3] -0.55000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model 'PDB ENTRY 2CDZ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.091 _refine.pdbx_overall_ESU_R_Free 0.081 _refine.overall_SU_ML 0.051 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2255 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 205 _refine_hist.number_atoms_total 2476 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 43.56 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.008 0.022 ? 2333 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 1602 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.147 1.985 ? 3166 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.895 3.000 ? 3918 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.219 5.000 ? 295 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 31.840 23.776 ? 98 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 11.338 15.037 ? 404 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 19.997 15.000 ? 17 'X-RAY DIFFRACTION' ? r_chiral_restr 0.069 0.200 ? 362 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.020 ? 2557 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 445 'X-RAY DIFFRACTION' ? r_nbd_refined 0.199 0.200 ? 450 'X-RAY DIFFRACTION' ? r_nbd_other 0.190 0.200 ? 1687 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.165 0.200 ? 1156 'X-RAY DIFFRACTION' ? r_nbtor_other 0.082 0.200 ? 1150 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.117 0.200 ? 144 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.098 0.200 ? 7 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.287 0.200 ? 26 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.143 0.200 ? 14 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 4.416 5.000 ? 1585 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 5.218 7.000 ? 2370 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 5.795 9.000 ? 940 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 7.346 12.000 ? 793 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.60 _refine_ls_shell.d_res_low 1.64 _refine_ls_shell.number_reflns_R_work 3201 _refine_ls_shell.R_factor_R_work 0.1750 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2810 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 176 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2J0I _struct.title 'CRYSTAL STRUCTURE OF THE HUMAN P21-ACTIVATED KINASE 4' _struct.pdbx_descriptor 'SERINE/THREONINE-PROTEIN KINASE PAK 4 (E.C.2.7.1.37, 2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2J0I _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;PROTEIN KINASE, PHOSPHORYLATION, NUCLEOTIDE-BINDING, PAK4, STE20, KINASE, TRANSFERASE, ATP-BINDING, ALTERNATIVE SPLICING, SERINE/THREONINE-PROTEIN KINASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? VAL A 24 ? SER A 300 VAL A 312 1 ? 13 HELX_P HELX_P2 2 ASP A 28 ? SER A 31 ? ASP A 316 SER A 319 5 ? 4 HELX_P HELX_P3 3 ARG A 71 ? GLU A 73 ? ARG A 359 GLU A 361 5 ? 3 HELX_P HELX_P4 4 LEU A 74 ? MET A 82 ? LEU A 362 MET A 370 1 ? 9 HELX_P HELX_P5 5 ALA A 114 ? THR A 122 ? ALA A 402 THR A 410 1 ? 9 HELX_P HELX_P6 6 ASN A 125 ? GLN A 146 ? ASN A 413 GLN A 434 1 ? 22 HELX_P HELX_P7 7 LYS A 154 ? ASP A 156 ? LYS A 442 ASP A 444 5 ? 3 HELX_P HELX_P8 8 THR A 190 ? MET A 194 ? THR A 478 MET A 482 5 ? 5 HELX_P HELX_P9 9 ALA A 195 ? SER A 200 ? ALA A 483 SER A 488 1 ? 6 HELX_P HELX_P10 10 PRO A 206 ? GLY A 223 ? PRO A 494 GLY A 511 1 ? 18 HELX_P HELX_P11 11 PRO A 231 ? ASN A 242 ? PRO A 519 ASN A 530 1 ? 12 HELX_P HELX_P12 12 ASN A 249 ? VAL A 253 ? ASN A 537 VAL A 541 5 ? 5 HELX_P HELX_P13 13 SER A 254 ? LEU A 265 ? SER A 542 LEU A 553 1 ? 12 HELX_P HELX_P14 14 THR A 274 ? LEU A 279 ? THR A 562 LEU A 567 1 ? 6 HELX_P HELX_P15 15 LYS A 280 ? ALA A 287 ? LYS A 568 ALA A 575 5 ? 8 HELX_P HELX_P16 16 PRO A 289 ? VAL A 294 ? PRO A 577 VAL A 582 1 ? 6 HELX_P HELX_P17 17 PRO A 295 ? MET A 297 ? PRO A 583 MET A 585 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A LYS 185 C ? ? ? 1_555 A SEP 186 N ? ? A LYS 473 A SEP 474 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale both ? A SEP 186 C ? ? ? 1_555 A LEU 187 N ? ? A SEP 474 A LEU 475 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 2 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LEU A 33 ? GLU A 41 ? LEU A 321 GLU A 329 AA 2 ILE A 46 ? VAL A 52 ? ILE A 334 VAL A 340 AA 3 LEU A 58 ? ASP A 65 ? LEU A 346 ASP A 353 AA 4 GLU A 102 ? MET A 107 ? GLU A 390 MET A 395 AA 5 MET A 93 ? VAL A 99 ? MET A 381 VAL A 387 AB 1 VAL A 148 ? ILE A 149 ? VAL A 436 ILE A 437 AB 2 ALA A 175 ? GLN A 176 ? ALA A 463 GLN A 464 AC 1 ILE A 158 ? LEU A 160 ? ILE A 446 LEU A 448 AC 2 VAL A 166 ? LEU A 168 ? VAL A 454 LEU A 456 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 39 ? N ILE A 327 O VAL A 47 ? O VAL A 335 AA 2 3 N ALA A 50 ? N ALA A 338 O VAL A 59 ? O VAL A 347 AA 3 4 N MET A 64 ? N MET A 352 O LEU A 103 ? O LEU A 391 AA 4 5 O VAL A 106 ? O VAL A 394 N TYR A 94 ? N TYR A 382 AB 1 2 N ILE A 149 ? N ILE A 437 O ALA A 175 ? O ALA A 463 AC 1 2 N LEU A 159 ? N LEU A 447 O LYS A 167 ? O LYS A 455 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO A1590' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A1591' AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A1592' AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A1593' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASN A 35 ? ASN A 323 . ? 1_555 ? 2 AC1 7 ILE A 37 ? ILE A 325 . ? 1_555 ? 3 AC1 7 ILE A 49 ? ILE A 337 . ? 1_555 ? 4 AC1 7 ALA A 50 ? ALA A 338 . ? 1_555 ? 5 AC1 7 THR A 51 ? THR A 339 . ? 1_555 ? 6 AC1 7 PHE A 76 ? PHE A 364 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 2054 . ? 1_555 ? 8 AC2 5 ILE A 39 ? ILE A 327 . ? 1_555 ? 9 AC2 5 PHE A 109 ? PHE A 397 . ? 1_555 ? 10 AC2 5 LEU A 110 ? LEU A 398 . ? 1_555 ? 11 AC2 5 HOH F . ? HOH A 2203 . ? 1_555 ? 12 AC2 5 HOH F . ? HOH A 2204 . ? 1_555 ? 13 AC3 4 LYS A 62 ? LYS A 350 . ? 1_555 ? 14 AC3 4 ASP A 152 ? ASP A 440 . ? 1_555 ? 15 AC3 4 ASP A 170 ? ASP A 458 . ? 1_555 ? 16 AC3 4 GLY A 172 ? GLY A 460 . ? 1_555 ? 17 AC4 5 GLU A 78 ? GLU A 366 . ? 1_555 ? 18 AC4 5 VAL A 91 ? VAL A 379 . ? 1_555 ? 19 AC4 5 LEU A 168 ? LEU A 456 . ? 1_555 ? 20 AC4 5 SER A 169 ? SER A 457 . ? 1_555 ? 21 AC4 5 PHE A 171 ? PHE A 459 . ? 1_555 ? # _database_PDB_matrix.entry_id 2J0I _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2J0I _atom_sites.fract_transf_matrix[1][1] 0.015745 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015745 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005603 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 289 ? ? ? A . n A 1 2 SER 2 290 ? ? ? A . n A 1 3 SER 3 291 ? ? ? A . n A 1 4 PRO 4 292 ? ? ? A . n A 1 5 GLN 5 293 ? ? ? A . n A 1 6 ARG 6 294 ? ? ? A . n A 1 7 GLU 7 295 ? ? ? A . n A 1 8 PRO 8 296 ? ? ? A . n A 1 9 GLN 9 297 ? ? ? A . n A 1 10 ARG 10 298 ? ? ? A . n A 1 11 VAL 11 299 ? ? ? A . n A 1 12 SER 12 300 300 SER SER A . n A 1 13 HIS 13 301 301 HIS HIS A . n A 1 14 GLU 14 302 302 GLU GLU A . n A 1 15 GLN 15 303 303 GLN GLN A . n A 1 16 PHE 16 304 304 PHE PHE A . n A 1 17 ARG 17 305 305 ARG ARG A . n A 1 18 ALA 18 306 306 ALA ALA A . n A 1 19 ALA 19 307 307 ALA ALA A . n A 1 20 LEU 20 308 308 LEU LEU A . n A 1 21 GLN 21 309 309 GLN GLN A . n A 1 22 LEU 22 310 310 LEU LEU A . n A 1 23 VAL 23 311 311 VAL VAL A . n A 1 24 VAL 24 312 312 VAL VAL A . n A 1 25 ASP 25 313 313 ASP ASP A . n A 1 26 PRO 26 314 314 PRO PRO A . n A 1 27 GLY 27 315 315 GLY GLY A . n A 1 28 ASP 28 316 316 ASP ASP A . n A 1 29 PRO 29 317 317 PRO PRO A . n A 1 30 ARG 30 318 318 ARG ARG A . n A 1 31 SER 31 319 319 SER SER A . n A 1 32 TYR 32 320 320 TYR TYR A . n A 1 33 LEU 33 321 321 LEU LEU A . n A 1 34 ASP 34 322 322 ASP ASP A . n A 1 35 ASN 35 323 323 ASN ASN A . n A 1 36 PHE 36 324 324 PHE PHE A . n A 1 37 ILE 37 325 325 ILE ILE A . n A 1 38 LYS 38 326 326 LYS LYS A . n A 1 39 ILE 39 327 327 ILE ILE A . n A 1 40 GLY 40 328 328 GLY GLY A . n A 1 41 GLU 41 329 329 GLU GLU A . n A 1 42 GLY 42 330 330 GLY GLY A . n A 1 43 SER 43 331 331 SER SER A . n A 1 44 THR 44 332 332 THR THR A . n A 1 45 GLY 45 333 333 GLY GLY A . n A 1 46 ILE 46 334 334 ILE ILE A . n A 1 47 VAL 47 335 335 VAL VAL A . n A 1 48 CYS 48 336 336 CYS CYS A . n A 1 49 ILE 49 337 337 ILE ILE A . n A 1 50 ALA 50 338 338 ALA ALA A . n A 1 51 THR 51 339 339 THR THR A . n A 1 52 VAL 52 340 340 VAL VAL A . n A 1 53 ARG 53 341 341 ARG ARG A . n A 1 54 SER 54 342 342 SER SER A . n A 1 55 SER 55 343 343 SER SER A . n A 1 56 GLY 56 344 344 GLY GLY A . n A 1 57 LYS 57 345 345 LYS LYS A . n A 1 58 LEU 58 346 346 LEU LEU A . n A 1 59 VAL 59 347 347 VAL VAL A . n A 1 60 ALA 60 348 348 ALA ALA A . n A 1 61 VAL 61 349 349 VAL VAL A . n A 1 62 LYS 62 350 350 LYS LYS A . n A 1 63 LYS 63 351 351 LYS LYS A . n A 1 64 MET 64 352 352 MET MET A . n A 1 65 ASP 65 353 353 ASP ASP A . n A 1 66 LEU 66 354 354 LEU LEU A . n A 1 67 ARG 67 355 355 ARG ARG A . n A 1 68 LYS 68 356 356 LYS LYS A . n A 1 69 GLN 69 357 357 GLN GLN A . n A 1 70 GLN 70 358 358 GLN GLN A . n A 1 71 ARG 71 359 359 ARG ARG A . n A 1 72 ARG 72 360 360 ARG ARG A . n A 1 73 GLU 73 361 361 GLU GLU A . n A 1 74 LEU 74 362 362 LEU LEU A . n A 1 75 LEU 75 363 363 LEU LEU A . n A 1 76 PHE 76 364 364 PHE PHE A . n A 1 77 ASN 77 365 365 ASN ASN A . n A 1 78 GLU 78 366 366 GLU GLU A . n A 1 79 VAL 79 367 367 VAL VAL A . n A 1 80 VAL 80 368 368 VAL VAL A . n A 1 81 ILE 81 369 369 ILE ILE A . n A 1 82 MET 82 370 370 MET MET A . n A 1 83 ARG 83 371 371 ARG ARG A . n A 1 84 ASP 84 372 372 ASP ASP A . n A 1 85 TYR 85 373 373 TYR TYR A . n A 1 86 GLN 86 374 374 GLN GLN A . n A 1 87 HIS 87 375 375 HIS HIS A . n A 1 88 GLU 88 376 376 GLU GLU A . n A 1 89 ASN 89 377 377 ASN ASN A . n A 1 90 VAL 90 378 378 VAL VAL A . n A 1 91 VAL 91 379 379 VAL VAL A . n A 1 92 GLU 92 380 380 GLU GLU A . n A 1 93 MET 93 381 381 MET MET A . n A 1 94 TYR 94 382 382 TYR TYR A . n A 1 95 ASN 95 383 383 ASN ASN A . n A 1 96 SER 96 384 384 SER SER A . n A 1 97 TYR 97 385 385 TYR TYR A . n A 1 98 LEU 98 386 386 LEU LEU A . n A 1 99 VAL 99 387 387 VAL VAL A . n A 1 100 GLY 100 388 388 GLY GLY A . n A 1 101 ASP 101 389 389 ASP ASP A . n A 1 102 GLU 102 390 390 GLU GLU A . n A 1 103 LEU 103 391 391 LEU LEU A . n A 1 104 TRP 104 392 392 TRP TRP A . n A 1 105 VAL 105 393 393 VAL VAL A . n A 1 106 VAL 106 394 394 VAL VAL A . n A 1 107 MET 107 395 395 MET MET A . n A 1 108 GLU 108 396 396 GLU GLU A . n A 1 109 PHE 109 397 397 PHE PHE A . n A 1 110 LEU 110 398 398 LEU LEU A . n A 1 111 GLU 111 399 399 GLU GLU A . n A 1 112 GLY 112 400 400 GLY GLY A . n A 1 113 GLY 113 401 401 GLY GLY A . n A 1 114 ALA 114 402 402 ALA ALA A . n A 1 115 LEU 115 403 403 LEU LEU A . n A 1 116 THR 116 404 404 THR THR A . n A 1 117 ASP 117 405 405 ASP ASP A . n A 1 118 ILE 118 406 406 ILE ILE A . n A 1 119 VAL 119 407 407 VAL VAL A . n A 1 120 THR 120 408 408 THR THR A . n A 1 121 HIS 121 409 409 HIS HIS A . n A 1 122 THR 122 410 410 THR THR A . n A 1 123 ARG 123 411 411 ARG ARG A . n A 1 124 MET 124 412 412 MET MET A . n A 1 125 ASN 125 413 413 ASN ASN A . n A 1 126 GLU 126 414 414 GLU GLU A . n A 1 127 GLU 127 415 415 GLU GLU A . n A 1 128 GLN 128 416 416 GLN GLN A . n A 1 129 ILE 129 417 417 ILE ILE A . n A 1 130 ALA 130 418 418 ALA ALA A . n A 1 131 ALA 131 419 419 ALA ALA A . n A 1 132 VAL 132 420 420 VAL VAL A . n A 1 133 CYS 133 421 421 CYS CYS A . n A 1 134 LEU 134 422 422 LEU LEU A . n A 1 135 ALA 135 423 423 ALA ALA A . n A 1 136 VAL 136 424 424 VAL VAL A . n A 1 137 LEU 137 425 425 LEU LEU A . n A 1 138 GLN 138 426 426 GLN GLN A . n A 1 139 ALA 139 427 427 ALA ALA A . n A 1 140 LEU 140 428 428 LEU LEU A . n A 1 141 SER 141 429 429 SER SER A . n A 1 142 VAL 142 430 430 VAL VAL A . n A 1 143 LEU 143 431 431 LEU LEU A . n A 1 144 HIS 144 432 432 HIS HIS A . n A 1 145 ALA 145 433 433 ALA ALA A . n A 1 146 GLN 146 434 434 GLN GLN A . n A 1 147 GLY 147 435 435 GLY GLY A . n A 1 148 VAL 148 436 436 VAL VAL A . n A 1 149 ILE 149 437 437 ILE ILE A . n A 1 150 HIS 150 438 438 HIS HIS A . n A 1 151 ARG 151 439 439 ARG ARG A . n A 1 152 ASP 152 440 440 ASP ASP A . n A 1 153 ILE 153 441 441 ILE ILE A . n A 1 154 LYS 154 442 442 LYS LYS A . n A 1 155 SER 155 443 443 SER SER A . n A 1 156 ASP 156 444 444 ASP ASP A . n A 1 157 SER 157 445 445 SER SER A . n A 1 158 ILE 158 446 446 ILE ILE A . n A 1 159 LEU 159 447 447 LEU LEU A . n A 1 160 LEU 160 448 448 LEU LEU A . n A 1 161 THR 161 449 449 THR THR A . n A 1 162 HIS 162 450 450 HIS HIS A . n A 1 163 ASP 163 451 451 ASP ASP A . n A 1 164 GLY 164 452 452 GLY GLY A . n A 1 165 ARG 165 453 453 ARG ARG A . n A 1 166 VAL 166 454 454 VAL VAL A . n A 1 167 LYS 167 455 455 LYS LYS A . n A 1 168 LEU 168 456 456 LEU LEU A . n A 1 169 SER 169 457 457 SER SER A . n A 1 170 ASP 170 458 458 ASP ASP A . n A 1 171 PHE 171 459 459 PHE PHE A . n A 1 172 GLY 172 460 460 GLY GLY A . n A 1 173 PHE 173 461 461 PHE PHE A . n A 1 174 CYS 174 462 462 CYS CYS A . n A 1 175 ALA 175 463 463 ALA ALA A . n A 1 176 GLN 176 464 464 GLN GLN A . n A 1 177 VAL 177 465 465 VAL VAL A . n A 1 178 SER 178 466 466 SER SER A . n A 1 179 LYS 179 467 467 LYS LYS A . n A 1 180 GLU 180 468 468 GLU GLU A . n A 1 181 VAL 181 469 469 VAL VAL A . n A 1 182 PRO 182 470 470 PRO PRO A . n A 1 183 ARG 183 471 471 ARG ARG A . n A 1 184 ARG 184 472 472 ARG ARG A . n A 1 185 LYS 185 473 473 LYS LYS A . n A 1 186 SEP 186 474 474 SEP SEP A . n A 1 187 LEU 187 475 475 LEU LEU A . n A 1 188 VAL 188 476 476 VAL VAL A . n A 1 189 GLY 189 477 477 GLY GLY A . n A 1 190 THR 190 478 478 THR THR A . n A 1 191 PRO 191 479 479 PRO PRO A . n A 1 192 TYR 192 480 480 TYR TYR A . n A 1 193 TRP 193 481 481 TRP TRP A . n A 1 194 MET 194 482 482 MET MET A . n A 1 195 ALA 195 483 483 ALA ALA A . n A 1 196 PRO 196 484 484 PRO PRO A . n A 1 197 GLU 197 485 485 GLU GLU A . n A 1 198 LEU 198 486 486 LEU LEU A . n A 1 199 ILE 199 487 487 ILE ILE A . n A 1 200 SER 200 488 488 SER SER A . n A 1 201 ARG 201 489 489 ARG ARG A . n A 1 202 LEU 202 490 490 LEU LEU A . n A 1 203 PRO 203 491 491 PRO PRO A . n A 1 204 TYR 204 492 492 TYR TYR A . n A 1 205 GLY 205 493 493 GLY GLY A . n A 1 206 PRO 206 494 494 PRO PRO A . n A 1 207 GLU 207 495 495 GLU GLU A . n A 1 208 VAL 208 496 496 VAL VAL A . n A 1 209 ASP 209 497 497 ASP ASP A . n A 1 210 ILE 210 498 498 ILE ILE A . n A 1 211 TRP 211 499 499 TRP TRP A . n A 1 212 SER 212 500 500 SER SER A . n A 1 213 LEU 213 501 501 LEU LEU A . n A 1 214 GLY 214 502 502 GLY GLY A . n A 1 215 ILE 215 503 503 ILE ILE A . n A 1 216 MET 216 504 504 MET MET A . n A 1 217 VAL 217 505 505 VAL VAL A . n A 1 218 ILE 218 506 506 ILE ILE A . n A 1 219 GLU 219 507 507 GLU GLU A . n A 1 220 MET 220 508 508 MET MET A . n A 1 221 VAL 221 509 509 VAL VAL A . n A 1 222 ASP 222 510 510 ASP ASP A . n A 1 223 GLY 223 511 511 GLY GLY A . n A 1 224 GLU 224 512 512 GLU GLU A . n A 1 225 PRO 225 513 513 PRO PRO A . n A 1 226 PRO 226 514 514 PRO PRO A . n A 1 227 TYR 227 515 515 TYR TYR A . n A 1 228 PHE 228 516 516 PHE PHE A . n A 1 229 ASN 229 517 517 ASN ASN A . n A 1 230 GLU 230 518 518 GLU GLU A . n A 1 231 PRO 231 519 519 PRO PRO A . n A 1 232 PRO 232 520 520 PRO PRO A . n A 1 233 LEU 233 521 521 LEU LEU A . n A 1 234 LYS 234 522 522 LYS LYS A . n A 1 235 ALA 235 523 523 ALA ALA A . n A 1 236 MET 236 524 524 MET MET A . n A 1 237 LYS 237 525 525 LYS LYS A . n A 1 238 MET 238 526 526 MET MET A . n A 1 239 ILE 239 527 527 ILE ILE A . n A 1 240 ARG 240 528 528 ARG ARG A . n A 1 241 ASP 241 529 529 ASP ASP A . n A 1 242 ASN 242 530 530 ASN ASN A . n A 1 243 LEU 243 531 531 LEU LEU A . n A 1 244 PRO 244 532 532 PRO PRO A . n A 1 245 PRO 245 533 533 PRO PRO A . n A 1 246 ARG 246 534 534 ARG ARG A . n A 1 247 LEU 247 535 535 LEU LEU A . n A 1 248 LYS 248 536 536 LYS LYS A . n A 1 249 ASN 249 537 537 ASN ASN A . n A 1 250 LEU 250 538 538 LEU LEU A . n A 1 251 HIS 251 539 539 HIS HIS A . n A 1 252 LYS 252 540 540 LYS LYS A . n A 1 253 VAL 253 541 541 VAL VAL A . n A 1 254 SER 254 542 542 SER SER A . n A 1 255 PRO 255 543 543 PRO PRO A . n A 1 256 SER 256 544 544 SER SER A . n A 1 257 LEU 257 545 545 LEU LEU A . n A 1 258 LYS 258 546 546 LYS LYS A . n A 1 259 GLY 259 547 547 GLY GLY A . n A 1 260 PHE 260 548 548 PHE PHE A . n A 1 261 LEU 261 549 549 LEU LEU A . n A 1 262 ASP 262 550 550 ASP ASP A . n A 1 263 ARG 263 551 551 ARG ARG A . n A 1 264 LEU 264 552 552 LEU LEU A . n A 1 265 LEU 265 553 553 LEU LEU A . n A 1 266 VAL 266 554 554 VAL VAL A . n A 1 267 ARG 267 555 555 ARG ARG A . n A 1 268 ASP 268 556 556 ASP ASP A . n A 1 269 PRO 269 557 557 PRO PRO A . n A 1 270 ALA 270 558 558 ALA ALA A . n A 1 271 GLN 271 559 559 GLN GLN A . n A 1 272 ARG 272 560 560 ARG ARG A . n A 1 273 ALA 273 561 561 ALA ALA A . n A 1 274 THR 274 562 562 THR THR A . n A 1 275 ALA 275 563 563 ALA ALA A . n A 1 276 ALA 276 564 564 ALA ALA A . n A 1 277 GLU 277 565 565 GLU GLU A . n A 1 278 LEU 278 566 566 LEU LEU A . n A 1 279 LEU 279 567 567 LEU LEU A . n A 1 280 LYS 280 568 568 LYS LYS A . n A 1 281 HIS 281 569 569 HIS HIS A . n A 1 282 PRO 282 570 570 PRO PRO A . n A 1 283 PHE 283 571 571 PHE PHE A . n A 1 284 LEU 284 572 572 LEU LEU A . n A 1 285 ALA 285 573 573 ALA ALA A . n A 1 286 LYS 286 574 574 LYS LYS A . n A 1 287 ALA 287 575 575 ALA ALA A . n A 1 288 GLY 288 576 576 GLY GLY A . n A 1 289 PRO 289 577 577 PRO PRO A . n A 1 290 PRO 290 578 578 PRO PRO A . n A 1 291 ALA 291 579 579 ALA ALA A . n A 1 292 SER 292 580 580 SER SER A . n A 1 293 ILE 293 581 581 ILE ILE A . n A 1 294 VAL 294 582 582 VAL VAL A . n A 1 295 PRO 295 583 583 PRO PRO A . n A 1 296 LEU 296 584 584 LEU LEU A . n A 1 297 MET 297 585 585 MET MET A . n A 1 298 ARG 298 586 586 ARG ARG A . n A 1 299 GLN 299 587 587 GLN GLN A . n A 1 300 ASN 300 588 588 ASN ASN A . n A 1 301 ARG 301 589 589 ARG ARG A . n A 1 302 THR 302 590 ? ? ? A . n A 1 303 ARG 303 591 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 1590 1590 EDO EDO A . C 2 EDO 1 1591 1591 EDO EDO A . D 2 EDO 1 1592 1592 EDO EDO A . E 2 EDO 1 1593 1593 EDO EDO A . F 3 HOH 1 2001 2001 HOH HOH A . F 3 HOH 2 2002 2002 HOH HOH A . F 3 HOH 3 2003 2003 HOH HOH A . F 3 HOH 4 2004 2004 HOH HOH A . F 3 HOH 5 2005 2005 HOH HOH A . F 3 HOH 6 2006 2006 HOH HOH A . F 3 HOH 7 2007 2007 HOH HOH A . F 3 HOH 8 2008 2008 HOH HOH A . F 3 HOH 9 2009 2009 HOH HOH A . F 3 HOH 10 2010 2010 HOH HOH A . F 3 HOH 11 2011 2011 HOH HOH A . F 3 HOH 12 2012 2012 HOH HOH A . F 3 HOH 13 2013 2013 HOH HOH A . F 3 HOH 14 2014 2014 HOH HOH A . F 3 HOH 15 2015 2015 HOH HOH A . F 3 HOH 16 2016 2016 HOH HOH A . F 3 HOH 17 2017 2017 HOH HOH A . F 3 HOH 18 2018 2018 HOH HOH A . F 3 HOH 19 2019 2019 HOH HOH A . F 3 HOH 20 2020 2020 HOH HOH A . F 3 HOH 21 2021 2021 HOH HOH A . F 3 HOH 22 2022 2022 HOH HOH A . F 3 HOH 23 2023 2023 HOH HOH A . F 3 HOH 24 2024 2024 HOH HOH A . F 3 HOH 25 2025 2025 HOH HOH A . F 3 HOH 26 2026 2026 HOH HOH A . F 3 HOH 27 2027 2027 HOH HOH A . F 3 HOH 28 2028 2028 HOH HOH A . F 3 HOH 29 2029 2029 HOH HOH A . F 3 HOH 30 2030 2030 HOH HOH A . F 3 HOH 31 2031 2031 HOH HOH A . F 3 HOH 32 2032 2032 HOH HOH A . F 3 HOH 33 2033 2033 HOH HOH A . F 3 HOH 34 2034 2034 HOH HOH A . F 3 HOH 35 2035 2035 HOH HOH A . F 3 HOH 36 2036 2036 HOH HOH A . F 3 HOH 37 2037 2037 HOH HOH A . F 3 HOH 38 2038 2038 HOH HOH A . F 3 HOH 39 2039 2039 HOH HOH A . F 3 HOH 40 2040 2040 HOH HOH A . F 3 HOH 41 2041 2041 HOH HOH A . F 3 HOH 42 2042 2042 HOH HOH A . F 3 HOH 43 2043 2043 HOH HOH A . F 3 HOH 44 2044 2044 HOH HOH A . F 3 HOH 45 2045 2045 HOH HOH A . F 3 HOH 46 2046 2046 HOH HOH A . F 3 HOH 47 2047 2047 HOH HOH A . F 3 HOH 48 2048 2048 HOH HOH A . F 3 HOH 49 2049 2049 HOH HOH A . F 3 HOH 50 2050 2050 HOH HOH A . F 3 HOH 51 2051 2051 HOH HOH A . F 3 HOH 52 2052 2052 HOH HOH A . F 3 HOH 53 2053 2053 HOH HOH A . F 3 HOH 54 2054 2054 HOH HOH A . F 3 HOH 55 2055 2055 HOH HOH A . F 3 HOH 56 2056 2056 HOH HOH A . F 3 HOH 57 2057 2057 HOH HOH A . F 3 HOH 58 2058 2058 HOH HOH A . F 3 HOH 59 2059 2059 HOH HOH A . F 3 HOH 60 2060 2060 HOH HOH A . F 3 HOH 61 2061 2061 HOH HOH A . F 3 HOH 62 2062 2062 HOH HOH A . F 3 HOH 63 2063 2063 HOH HOH A . F 3 HOH 64 2064 2064 HOH HOH A . F 3 HOH 65 2065 2065 HOH HOH A . F 3 HOH 66 2066 2066 HOH HOH A . F 3 HOH 67 2067 2067 HOH HOH A . F 3 HOH 68 2068 2068 HOH HOH A . F 3 HOH 69 2069 2069 HOH HOH A . F 3 HOH 70 2070 2070 HOH HOH A . F 3 HOH 71 2071 2071 HOH HOH A . F 3 HOH 72 2072 2072 HOH HOH A . F 3 HOH 73 2073 2073 HOH HOH A . F 3 HOH 74 2074 2074 HOH HOH A . F 3 HOH 75 2075 2075 HOH HOH A . F 3 HOH 76 2076 2076 HOH HOH A . F 3 HOH 77 2077 2077 HOH HOH A . F 3 HOH 78 2078 2078 HOH HOH A . F 3 HOH 79 2079 2079 HOH HOH A . F 3 HOH 80 2080 2080 HOH HOH A . F 3 HOH 81 2081 2081 HOH HOH A . F 3 HOH 82 2082 2082 HOH HOH A . F 3 HOH 83 2083 2083 HOH HOH A . F 3 HOH 84 2084 2084 HOH HOH A . F 3 HOH 85 2085 2085 HOH HOH A . F 3 HOH 86 2086 2086 HOH HOH A . F 3 HOH 87 2087 2087 HOH HOH A . F 3 HOH 88 2088 2088 HOH HOH A . F 3 HOH 89 2089 2089 HOH HOH A . F 3 HOH 90 2090 2090 HOH HOH A . F 3 HOH 91 2091 2091 HOH HOH A . F 3 HOH 92 2092 2092 HOH HOH A . F 3 HOH 93 2093 2093 HOH HOH A . F 3 HOH 94 2094 2094 HOH HOH A . F 3 HOH 95 2095 2095 HOH HOH A . F 3 HOH 96 2096 2096 HOH HOH A . F 3 HOH 97 2097 2097 HOH HOH A . F 3 HOH 98 2098 2098 HOH HOH A . F 3 HOH 99 2099 2099 HOH HOH A . F 3 HOH 100 2100 2100 HOH HOH A . F 3 HOH 101 2101 2101 HOH HOH A . F 3 HOH 102 2102 2102 HOH HOH A . F 3 HOH 103 2103 2103 HOH HOH A . F 3 HOH 104 2104 2104 HOH HOH A . F 3 HOH 105 2105 2105 HOH HOH A . F 3 HOH 106 2106 2106 HOH HOH A . F 3 HOH 107 2107 2107 HOH HOH A . F 3 HOH 108 2108 2108 HOH HOH A . F 3 HOH 109 2109 2109 HOH HOH A . F 3 HOH 110 2110 2110 HOH HOH A . F 3 HOH 111 2111 2111 HOH HOH A . F 3 HOH 112 2112 2112 HOH HOH A . F 3 HOH 113 2113 2113 HOH HOH A . F 3 HOH 114 2114 2114 HOH HOH A . F 3 HOH 115 2115 2115 HOH HOH A . F 3 HOH 116 2116 2116 HOH HOH A . F 3 HOH 117 2117 2117 HOH HOH A . F 3 HOH 118 2118 2118 HOH HOH A . F 3 HOH 119 2119 2119 HOH HOH A . F 3 HOH 120 2120 2120 HOH HOH A . F 3 HOH 121 2121 2121 HOH HOH A . F 3 HOH 122 2122 2122 HOH HOH A . F 3 HOH 123 2123 2123 HOH HOH A . F 3 HOH 124 2124 2124 HOH HOH A . F 3 HOH 125 2125 2125 HOH HOH A . F 3 HOH 126 2126 2126 HOH HOH A . F 3 HOH 127 2127 2127 HOH HOH A . F 3 HOH 128 2128 2128 HOH HOH A . F 3 HOH 129 2129 2129 HOH HOH A . F 3 HOH 130 2130 2130 HOH HOH A . F 3 HOH 131 2131 2131 HOH HOH A . F 3 HOH 132 2132 2132 HOH HOH A . F 3 HOH 133 2133 2133 HOH HOH A . F 3 HOH 134 2134 2134 HOH HOH A . F 3 HOH 135 2135 2135 HOH HOH A . F 3 HOH 136 2136 2136 HOH HOH A . F 3 HOH 137 2137 2137 HOH HOH A . F 3 HOH 138 2138 2138 HOH HOH A . F 3 HOH 139 2139 2139 HOH HOH A . F 3 HOH 140 2140 2140 HOH HOH A . F 3 HOH 141 2141 2141 HOH HOH A . F 3 HOH 142 2142 2142 HOH HOH A . F 3 HOH 143 2143 2143 HOH HOH A . F 3 HOH 144 2144 2144 HOH HOH A . F 3 HOH 145 2145 2145 HOH HOH A . F 3 HOH 146 2146 2146 HOH HOH A . F 3 HOH 147 2147 2147 HOH HOH A . F 3 HOH 148 2148 2148 HOH HOH A . F 3 HOH 149 2149 2149 HOH HOH A . F 3 HOH 150 2150 2150 HOH HOH A . F 3 HOH 151 2151 2151 HOH HOH A . F 3 HOH 152 2152 2152 HOH HOH A . F 3 HOH 153 2153 2153 HOH HOH A . F 3 HOH 154 2154 2154 HOH HOH A . F 3 HOH 155 2155 2155 HOH HOH A . F 3 HOH 156 2156 2156 HOH HOH A . F 3 HOH 157 2157 2157 HOH HOH A . F 3 HOH 158 2158 2158 HOH HOH A . F 3 HOH 159 2159 2159 HOH HOH A . F 3 HOH 160 2160 2160 HOH HOH A . F 3 HOH 161 2161 2161 HOH HOH A . F 3 HOH 162 2162 2162 HOH HOH A . F 3 HOH 163 2163 2163 HOH HOH A . F 3 HOH 164 2164 2164 HOH HOH A . F 3 HOH 165 2165 2165 HOH HOH A . F 3 HOH 166 2166 2166 HOH HOH A . F 3 HOH 167 2167 2167 HOH HOH A . F 3 HOH 168 2168 2168 HOH HOH A . F 3 HOH 169 2169 2169 HOH HOH A . F 3 HOH 170 2170 2170 HOH HOH A . F 3 HOH 171 2171 2171 HOH HOH A . F 3 HOH 172 2172 2172 HOH HOH A . F 3 HOH 173 2173 2173 HOH HOH A . F 3 HOH 174 2174 2174 HOH HOH A . F 3 HOH 175 2175 2175 HOH HOH A . F 3 HOH 176 2176 2176 HOH HOH A . F 3 HOH 177 2177 2177 HOH HOH A . F 3 HOH 178 2178 2178 HOH HOH A . F 3 HOH 179 2179 2179 HOH HOH A . F 3 HOH 180 2180 2180 HOH HOH A . F 3 HOH 181 2181 2181 HOH HOH A . F 3 HOH 182 2182 2182 HOH HOH A . F 3 HOH 183 2183 2183 HOH HOH A . F 3 HOH 184 2184 2184 HOH HOH A . F 3 HOH 185 2185 2185 HOH HOH A . F 3 HOH 186 2186 2186 HOH HOH A . F 3 HOH 187 2187 2187 HOH HOH A . F 3 HOH 188 2188 2188 HOH HOH A . F 3 HOH 189 2189 2189 HOH HOH A . F 3 HOH 190 2190 2190 HOH HOH A . F 3 HOH 191 2191 2191 HOH HOH A . F 3 HOH 192 2192 2192 HOH HOH A . F 3 HOH 193 2193 2193 HOH HOH A . F 3 HOH 194 2194 2194 HOH HOH A . F 3 HOH 195 2195 2195 HOH HOH A . F 3 HOH 196 2196 2196 HOH HOH A . F 3 HOH 197 2197 2197 HOH HOH A . F 3 HOH 198 2198 2198 HOH HOH A . F 3 HOH 199 2199 2199 HOH HOH A . F 3 HOH 200 2200 2200 HOH HOH A . F 3 HOH 201 2201 2201 HOH HOH A . F 3 HOH 202 2202 2202 HOH HOH A . F 3 HOH 203 2203 2203 HOH HOH A . F 3 HOH 204 2204 2204 HOH HOH A . F 3 HOH 205 2205 2205 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 186 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 474 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details PHOSPHOSERINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-17 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-24 5 'Structure model' 1 4 2018-01-31 6 'Structure model' 1 5 2019-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Structure summary' 5 5 'Structure model' 'Source and taxonomy' 6 6 'Structure model' 'Data collection' 7 6 'Structure model' 'Derived calculations' 8 6 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' citation_author 3 5 'Structure model' entity_src_gen 4 6 'Structure model' database_PDB_rev 5 6 'Structure model' database_PDB_rev_record 6 6 'Structure model' exptl_crystal_grow 7 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.name' 2 4 'Structure model' '_citation_author.name' 3 5 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 4 5 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 5 5 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 6 6 'Structure model' '_exptl_crystal_grow.method' 7 6 'Structure model' '_exptl_crystal_grow.temp' 8 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 PHASER phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 372 ? ? 59.21 17.26 2 1 ASP A 440 ? ? -141.28 45.26 3 1 PRO A 491 ? ? -37.36 115.85 4 1 ASN A 537 ? ? -96.17 30.75 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 358 ? CD ? A GLN 70 CD 2 1 Y 1 A GLN 358 ? OE1 ? A GLN 70 OE1 3 1 Y 1 A GLN 358 ? NE2 ? A GLN 70 NE2 4 1 Y 1 A GLN 374 ? CD ? A GLN 86 CD 5 1 Y 1 A GLN 374 ? OE1 ? A GLN 86 OE1 6 1 Y 1 A GLN 374 ? NE2 ? A GLN 86 NE2 7 1 Y 1 A GLU 376 ? CD ? A GLU 88 CD 8 1 Y 1 A GLU 376 ? OE1 ? A GLU 88 OE1 9 1 Y 1 A GLU 376 ? OE2 ? A GLU 88 OE2 10 1 Y 1 A ARG 411 ? CD ? A ARG 123 CD 11 1 Y 1 A ARG 411 ? NE ? A ARG 123 NE 12 1 Y 1 A ARG 411 ? CZ ? A ARG 123 CZ 13 1 Y 1 A ARG 411 ? NH1 ? A ARG 123 NH1 14 1 Y 1 A ARG 411 ? NH2 ? A ARG 123 NH2 15 1 Y 1 A LYS 467 ? CD ? A LYS 179 CD 16 1 Y 1 A LYS 467 ? CE ? A LYS 179 CE 17 1 Y 1 A LYS 467 ? NZ ? A LYS 179 NZ 18 1 Y 1 A ARG 471 ? CD ? A ARG 183 CD 19 1 Y 1 A ARG 471 ? NE ? A ARG 183 NE 20 1 Y 1 A ARG 471 ? CZ ? A ARG 183 CZ 21 1 Y 1 A ARG 471 ? NH1 ? A ARG 183 NH1 22 1 Y 1 A ARG 471 ? NH2 ? A ARG 183 NH2 23 1 Y 1 A LYS 522 ? CG ? A LYS 234 CG 24 1 Y 1 A LYS 522 ? CD ? A LYS 234 CD 25 1 Y 1 A LYS 522 ? CE ? A LYS 234 CE 26 1 Y 1 A LYS 522 ? NZ ? A LYS 234 NZ 27 1 Y 1 A LYS 525 ? CG ? A LYS 237 CG 28 1 Y 1 A LYS 525 ? CD ? A LYS 237 CD 29 1 Y 1 A LYS 525 ? CE ? A LYS 237 CE 30 1 Y 1 A LYS 525 ? NZ ? A LYS 237 NZ 31 1 Y 1 A ARG 534 ? CG ? A ARG 246 CG 32 1 Y 1 A ARG 534 ? CD ? A ARG 246 CD 33 1 Y 1 A ARG 534 ? NE ? A ARG 246 NE 34 1 Y 1 A ARG 534 ? CZ ? A ARG 246 CZ 35 1 Y 1 A ARG 534 ? NH1 ? A ARG 246 NH1 36 1 Y 1 A ARG 534 ? NH2 ? A ARG 246 NH2 37 1 Y 1 A LYS 536 ? CD ? A LYS 248 CD 38 1 Y 1 A LYS 536 ? CE ? A LYS 248 CE 39 1 Y 1 A LYS 536 ? NZ ? A LYS 248 NZ 40 1 Y 1 A LYS 568 ? NZ ? A LYS 280 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 289 ? A GLY 1 2 1 Y 1 A SER 290 ? A SER 2 3 1 Y 1 A SER 291 ? A SER 3 4 1 Y 1 A PRO 292 ? A PRO 4 5 1 Y 1 A GLN 293 ? A GLN 5 6 1 Y 1 A ARG 294 ? A ARG 6 7 1 Y 1 A GLU 295 ? A GLU 7 8 1 Y 1 A PRO 296 ? A PRO 8 9 1 Y 1 A GLN 297 ? A GLN 9 10 1 Y 1 A ARG 298 ? A ARG 10 11 1 Y 1 A VAL 299 ? A VAL 11 12 1 Y 1 A THR 590 ? A THR 302 13 1 Y 1 A ARG 591 ? A ARG 303 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH #