data_2J2S # _entry.id 2J2S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2J2S pdb_00002j2s 10.2210/pdb2j2s/pdb PDBE EBI-29736 ? ? WWPDB D_1290029736 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-21 2 'Structure model' 1 1 2017-04-19 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Other 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_mr' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.value' 12 3 'Structure model' '_struct_conn.pdbx_dist_value' 13 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 14 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 15 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 16 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 17 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 19 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 20 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 21 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 22 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 24 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2J2S _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-08-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2AGH _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'STRUCTURAL BASIS FOR COOPERATIVE TRANSCRIPTION FACTORBINDING TO THE CBP COACTIVATOR' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Allen, M.D.' 1 'Grummitt, C.G.' 2 'Hilcenko, C.' 3 'Young-Min, S.' 4 'Tonkin, L.M.' 5 'Johnson, C.M.' 6 'Bycroft, M.' 7 'Warren, A.J.' 8 # _citation.id primary _citation.title 'Solution Structure of the Nonmethyl-Cpg-Binding Cxxc Domain of the Leukaemia-Associated Mll Histone Methyltransferase' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 25 _citation.page_first 4503 _citation.page_last ? _citation.year 2006 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16990798 _citation.pdbx_database_id_DOI 10.1038/SJ.EMBOJ.7601340 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Allen, M.D.' 1 ? primary 'Grummitt, C.G.' 2 ? primary 'Hilcenko, C.' 3 ? primary 'Min, S.Y.' 4 ? primary 'Tonkin, L.M.' 5 ? primary 'Johnson, C.M.' 6 ? primary 'Freund, S.M.' 7 ? primary 'Bycroft, M.' 8 ? primary 'Warren, A.J.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ZINC FINGER PROTEIN HRX' 8066.666 1 ? YES 'RESIDUES 1146-1214' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ALL-1, TRITHORAX-LIKE PROTEIN, CXXC DOMAIN OF MLL-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGSVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVK _entity_poly.pdbx_seq_one_letter_code_can GGSVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 SER n 1 4 VAL n 1 5 LYS n 1 6 LYS n 1 7 GLY n 1 8 ARG n 1 9 ARG n 1 10 SER n 1 11 ARG n 1 12 ARG n 1 13 CYS n 1 14 GLY n 1 15 GLN n 1 16 CYS n 1 17 PRO n 1 18 GLY n 1 19 CYS n 1 20 GLN n 1 21 VAL n 1 22 PRO n 1 23 GLU n 1 24 ASP n 1 25 CYS n 1 26 GLY n 1 27 VAL n 1 28 CYS n 1 29 THR n 1 30 ASN n 1 31 CYS n 1 32 LEU n 1 33 ASP n 1 34 LYS n 1 35 PRO n 1 36 LYS n 1 37 PHE n 1 38 GLY n 1 39 GLY n 1 40 ARG n 1 41 ASN n 1 42 ILE n 1 43 LYS n 1 44 LYS n 1 45 GLN n 1 46 CYS n 1 47 CYS n 1 48 LYS n 1 49 MET n 1 50 ARG n 1 51 LYS n 1 52 CYS n 1 53 GLN n 1 54 ASN n 1 55 LEU n 1 56 GLN n 1 57 TRP n 1 58 MET n 1 59 PRO n 1 60 SER n 1 61 LYS n 1 62 ALA n 1 63 TYR n 1 64 LEU n 1 65 GLN n 1 66 LYS n 1 67 GLN n 1 68 ALA n 1 69 LYS n 1 70 ALA n 1 71 VAL n 1 72 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain TUNER _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'PRSETA (MODIFIED)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1143 1143 GLY GLY A . n A 1 2 GLY 2 1144 1144 GLY GLY A . n A 1 3 SER 3 1145 1145 SER SER A . n A 1 4 VAL 4 1146 1146 VAL VAL A . n A 1 5 LYS 5 1147 1147 LYS LYS A . n A 1 6 LYS 6 1148 1148 LYS LYS A . n A 1 7 GLY 7 1149 1149 GLY GLY A . n A 1 8 ARG 8 1150 1150 ARG ARG A . n A 1 9 ARG 9 1151 1151 ARG ARG A . n A 1 10 SER 10 1152 1152 SER SER A . n A 1 11 ARG 11 1153 1153 ARG ARG A . n A 1 12 ARG 12 1154 1154 ARG ARG A . n A 1 13 CYS 13 1155 1155 CYS CYS A . n A 1 14 GLY 14 1156 1156 GLY GLY A . n A 1 15 GLN 15 1157 1157 GLN GLN A . n A 1 16 CYS 16 1158 1158 CYS CYS A . n A 1 17 PRO 17 1159 1159 PRO PRO A . n A 1 18 GLY 18 1160 1160 GLY GLY A . n A 1 19 CYS 19 1161 1161 CYS CYS A . n A 1 20 GLN 20 1162 1162 GLN GLN A . n A 1 21 VAL 21 1163 1163 VAL VAL A . n A 1 22 PRO 22 1164 1164 PRO PRO A . n A 1 23 GLU 23 1165 1165 GLU GLU A . n A 1 24 ASP 24 1166 1166 ASP ASP A . n A 1 25 CYS 25 1167 1167 CYS CYS A . n A 1 26 GLY 26 1168 1168 GLY GLY A . n A 1 27 VAL 27 1169 1169 VAL VAL A . n A 1 28 CYS 28 1170 1170 CYS CYS A . n A 1 29 THR 29 1171 1171 THR THR A . n A 1 30 ASN 30 1172 1172 ASN ASN A . n A 1 31 CYS 31 1173 1173 CYS CYS A . n A 1 32 LEU 32 1174 1174 LEU LEU A . n A 1 33 ASP 33 1175 1175 ASP ASP A . n A 1 34 LYS 34 1176 1176 LYS LYS A . n A 1 35 PRO 35 1177 1177 PRO PRO A . n A 1 36 LYS 36 1178 1178 LYS LYS A . n A 1 37 PHE 37 1179 1179 PHE PHE A . n A 1 38 GLY 38 1180 1180 GLY GLY A . n A 1 39 GLY 39 1181 1181 GLY GLY A . n A 1 40 ARG 40 1182 1182 ARG ARG A . n A 1 41 ASN 41 1183 1183 ASN ASN A . n A 1 42 ILE 42 1184 1184 ILE ILE A . n A 1 43 LYS 43 1185 1185 LYS LYS A . n A 1 44 LYS 44 1186 1186 LYS LYS A . n A 1 45 GLN 45 1187 1187 GLN GLN A . n A 1 46 CYS 46 1188 1188 CYS CYS A . n A 1 47 CYS 47 1189 1189 CYS CYS A . n A 1 48 LYS 48 1190 1190 LYS LYS A . n A 1 49 MET 49 1191 1191 MET MET A . n A 1 50 ARG 50 1192 1192 ARG ARG A . n A 1 51 LYS 51 1193 1193 LYS LYS A . n A 1 52 CYS 52 1194 1194 CYS CYS A . n A 1 53 GLN 53 1195 1195 GLN GLN A . n A 1 54 ASN 54 1196 1196 ASN ASN A . n A 1 55 LEU 55 1197 1197 LEU LEU A . n A 1 56 GLN 56 1198 1198 GLN GLN A . n A 1 57 TRP 57 1199 1199 TRP TRP A . n A 1 58 MET 58 1200 1200 MET MET A . n A 1 59 PRO 59 1201 1201 PRO PRO A . n A 1 60 SER 60 1202 1202 SER SER A . n A 1 61 LYS 61 1203 1203 LYS LYS A . n A 1 62 ALA 62 1204 1204 ALA ALA A . n A 1 63 TYR 63 1205 1205 TYR TYR A . n A 1 64 LEU 64 1206 1206 LEU LEU A . n A 1 65 GLN 65 1207 1207 GLN GLN A . n A 1 66 LYS 66 1208 1208 LYS LYS A . n A 1 67 GLN 67 1209 1209 GLN GLN A . n A 1 68 ALA 68 1210 1210 ALA ALA A . n A 1 69 LYS 69 1211 1211 LYS LYS A . n A 1 70 ALA 70 1212 1212 ALA ALA A . n A 1 71 VAL 71 1213 1213 VAL VAL A . n A 1 72 LYS 72 1214 1214 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 2215 2215 ZN ZN A . C 2 ZN 1 2216 2216 ZN ZN A . # _cell.entry_id 2J2S _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2J2S _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2J2S _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2J2S _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2J2S _struct.title 'Solution structure of the nonmethyl-CpG-binding CXXC domain of the leukaemia-associated MLL histone methyltransferase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2J2S _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATION' _struct_keywords.text ;TRANSCRIPTION REGULATION, CHROMOSOMAL REARRANGEMENT, ZINC-FINGER, DNA-BINDING, BROMODOMAIN, POLYMORPHISM, MIXED LINEAGE LEUKAEMIA, ZINC BINDING, TRANSCRIPTION, METAL-BINDING, ZINC, CXXC, MBD1, HOX GENES, CHROMATIN, METHYLATION, PROTO-ONCOGENE, NUCLEAR PROTEIN, PHOSPHORYLATION, CPG DINUCLEOTIDE, ALTERNATIVE SPLICING ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HRX_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q03164 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2J2S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q03164 _struct_ref_seq.db_align_beg 1143 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1214 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1143 _struct_ref_seq.pdbx_auth_seq_align_end 1214 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2J2S GLY A 1 ? UNP Q03164 GLU 1143 'engineered mutation' 1143 1 1 2J2S GLY A 2 ? UNP Q03164 PRO 1144 'engineered mutation' 1144 2 1 2J2S SER A 3 ? UNP Q03164 PRO 1145 'engineered mutation' 1145 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 28 ? ASP A 33 ? CYS A 1170 ASP A 1175 1 ? 6 HELX_P HELX_P2 2 LYS A 34 ? GLY A 38 ? LYS A 1176 GLY A 1180 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 1155 A ZN 2216 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 1158 A ZN 2216 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc3 metalc ? ? A CYS 19 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 1161 A ZN 2216 1_555 ? ? ? ? ? ? ? 2.216 ? ? metalc4 metalc ? ? A CYS 25 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1167 A ZN 2215 1_555 ? ? ? ? ? ? ? 2.195 ? ? metalc5 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1170 A ZN 2215 1_555 ? ? ? ? ? ? ? 2.214 ? ? metalc6 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1173 A ZN 2215 1_555 ? ? ? ? ? ? ? 2.287 ? ? metalc7 metalc ? ? A CYS 47 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 1189 A ZN 2215 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc8 metalc ? ? A CYS 52 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 1194 A ZN 2216 1_555 ? ? ? ? ? ? ? 2.349 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 1155 ? 1_555 ZN ? C ZN . ? A ZN 2216 ? 1_555 SG ? A CYS 16 ? A CYS 1158 ? 1_555 100.9 ? 2 SG ? A CYS 13 ? A CYS 1155 ? 1_555 ZN ? C ZN . ? A ZN 2216 ? 1_555 SG ? A CYS 19 ? A CYS 1161 ? 1_555 126.8 ? 3 SG ? A CYS 16 ? A CYS 1158 ? 1_555 ZN ? C ZN . ? A ZN 2216 ? 1_555 SG ? A CYS 19 ? A CYS 1161 ? 1_555 116.5 ? 4 SG ? A CYS 13 ? A CYS 1155 ? 1_555 ZN ? C ZN . ? A ZN 2216 ? 1_555 SG ? A CYS 52 ? A CYS 1194 ? 1_555 103.2 ? 5 SG ? A CYS 16 ? A CYS 1158 ? 1_555 ZN ? C ZN . ? A ZN 2216 ? 1_555 SG ? A CYS 52 ? A CYS 1194 ? 1_555 100.0 ? 6 SG ? A CYS 19 ? A CYS 1161 ? 1_555 ZN ? C ZN . ? A ZN 2216 ? 1_555 SG ? A CYS 52 ? A CYS 1194 ? 1_555 105.7 ? 7 SG ? A CYS 25 ? A CYS 1167 ? 1_555 ZN ? B ZN . ? A ZN 2215 ? 1_555 SG ? A CYS 28 ? A CYS 1170 ? 1_555 106.2 ? 8 SG ? A CYS 25 ? A CYS 1167 ? 1_555 ZN ? B ZN . ? A ZN 2215 ? 1_555 SG ? A CYS 31 ? A CYS 1173 ? 1_555 109.7 ? 9 SG ? A CYS 28 ? A CYS 1170 ? 1_555 ZN ? B ZN . ? A ZN 2215 ? 1_555 SG ? A CYS 31 ? A CYS 1173 ? 1_555 102.9 ? 10 SG ? A CYS 25 ? A CYS 1167 ? 1_555 ZN ? B ZN . ? A ZN 2215 ? 1_555 SG ? A CYS 47 ? A CYS 1189 ? 1_555 114.6 ? 11 SG ? A CYS 28 ? A CYS 1170 ? 1_555 ZN ? B ZN . ? A ZN 2215 ? 1_555 SG ? A CYS 47 ? A CYS 1189 ? 1_555 123.9 ? 12 SG ? A CYS 31 ? A CYS 1173 ? 1_555 ZN ? B ZN . ? A ZN 2215 ? 1_555 SG ? A CYS 47 ? A CYS 1189 ? 1_555 97.8 ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ARG A 9 ? ARG A 12 ? ARG A 1151 ARG A 1154 AA 2 LEU A 55 ? MET A 58 ? LEU A 1197 MET A 1200 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 1153 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 56 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 1198 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A2215' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN A2216' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 25 ? CYS A 1167 . ? 1_555 ? 2 AC1 4 CYS A 28 ? CYS A 1170 . ? 1_555 ? 3 AC1 4 CYS A 31 ? CYS A 1173 . ? 1_555 ? 4 AC1 4 CYS A 47 ? CYS A 1189 . ? 1_555 ? 5 AC2 6 CYS A 13 ? CYS A 1155 . ? 1_555 ? 6 AC2 6 GLY A 14 ? GLY A 1156 . ? 1_555 ? 7 AC2 6 CYS A 16 ? CYS A 1158 . ? 1_555 ? 8 AC2 6 CYS A 19 ? CYS A 1161 . ? 1_555 ? 9 AC2 6 CYS A 52 ? CYS A 1194 . ? 1_555 ? 10 AC2 6 ASN A 54 ? ASN A 1196 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 1147 ? ? -135.69 -67.60 2 1 LYS A 1148 ? ? -98.47 30.12 3 1 GLN A 1157 ? ? -154.96 25.04 4 1 VAL A 1169 ? ? -144.01 -6.21 5 1 ARG A 1182 ? ? -148.20 17.55 6 1 LYS A 1186 ? ? 15.15 70.02 7 1 LYS A 1208 ? ? -63.20 -178.05 8 1 ALA A 1210 ? ? -146.68 36.76 9 2 GLN A 1157 ? ? -154.78 26.77 10 2 VAL A 1169 ? ? -144.63 -6.54 11 2 ARG A 1182 ? ? -148.65 17.52 12 2 ASN A 1183 ? ? 58.31 19.46 13 2 LYS A 1186 ? ? 16.38 85.58 14 2 TYR A 1205 ? ? 42.65 -90.52 15 2 ALA A 1212 ? ? 59.47 156.61 16 2 VAL A 1213 ? ? -152.30 -46.31 17 3 SER A 1145 ? ? -69.36 82.63 18 3 LYS A 1147 ? ? 59.47 161.55 19 3 GLN A 1157 ? ? -155.22 27.70 20 3 VAL A 1169 ? ? -141.61 -12.24 21 3 ARG A 1182 ? ? -153.19 19.77 22 3 LYS A 1186 ? ? 15.91 61.69 23 3 LYS A 1203 ? ? -106.64 40.12 24 4 GLN A 1157 ? ? -156.56 32.77 25 4 VAL A 1169 ? ? -144.68 -7.64 26 4 ARG A 1182 ? ? -146.28 18.34 27 4 LYS A 1186 ? ? 12.74 72.42 28 4 ALA A 1204 ? ? 71.13 86.01 29 4 GLN A 1207 ? ? 68.92 -67.74 30 5 LYS A 1147 ? ? -156.50 -75.67 31 5 GLN A 1157 ? ? -153.40 21.48 32 5 ASN A 1183 ? ? 58.77 17.71 33 5 LYS A 1186 ? ? 17.84 81.43 34 5 TYR A 1205 ? ? 41.04 -89.61 35 5 GLN A 1209 ? ? -160.34 -78.18 36 6 GLN A 1157 ? ? -153.54 24.66 37 6 VAL A 1169 ? ? -145.03 -2.99 38 6 LYS A 1186 ? ? 25.65 87.83 39 6 SER A 1202 ? ? 57.24 170.71 40 6 LYS A 1211 ? ? -119.62 56.61 41 6 ALA A 1212 ? ? -152.19 -77.71 42 6 VAL A 1213 ? ? -62.61 83.71 43 7 SER A 1145 ? ? -92.78 -77.32 44 7 LYS A 1147 ? ? 169.79 145.89 45 7 GLN A 1157 ? ? -152.87 22.69 46 7 VAL A 1169 ? ? -143.91 -7.79 47 7 LYS A 1186 ? ? 31.99 81.18 48 7 TYR A 1205 ? ? 41.37 -89.99 49 7 ALA A 1210 ? ? -106.89 76.83 50 7 ALA A 1212 ? ? -84.33 -72.47 51 8 LYS A 1147 ? ? -127.02 -80.87 52 8 LYS A 1148 ? ? -178.16 37.98 53 8 GLN A 1157 ? ? -154.38 25.05 54 8 VAL A 1169 ? ? -145.45 -1.21 55 8 LYS A 1186 ? ? 23.97 82.17 56 8 LYS A 1203 ? ? -98.59 31.90 57 8 LYS A 1208 ? ? 58.65 102.74 58 8 ALA A 1210 ? ? -179.33 -38.85 59 9 SER A 1145 ? ? -151.99 -46.43 60 9 LYS A 1148 ? ? 60.00 93.59 61 9 GLN A 1157 ? ? -155.48 25.96 62 9 VAL A 1169 ? ? -145.16 -5.98 63 9 LYS A 1186 ? ? 12.45 91.55 64 9 LYS A 1203 ? ? -147.25 36.70 65 9 ALA A 1204 ? ? -135.24 -71.81 66 9 TYR A 1205 ? ? 42.52 -89.69 67 9 LYS A 1211 ? ? 59.13 176.68 68 9 VAL A 1213 ? ? -141.61 31.13 69 10 VAL A 1146 ? ? -93.10 48.06 70 10 LYS A 1148 ? ? 61.50 152.13 71 10 GLN A 1157 ? ? -155.67 26.14 72 10 LYS A 1186 ? ? 24.66 82.72 73 10 LYS A 1203 ? ? -95.25 43.10 74 10 ALA A 1210 ? ? -104.94 77.01 75 11 GLN A 1157 ? ? -155.06 24.92 76 11 VAL A 1169 ? ? -143.90 -3.90 77 11 LYS A 1186 ? ? 27.60 83.75 78 12 GLN A 1157 ? ? -153.31 23.68 79 12 VAL A 1169 ? ? -145.16 -5.29 80 12 LYS A 1186 ? ? 15.03 91.75 81 12 SER A 1202 ? ? 57.19 166.50 82 12 ALA A 1204 ? ? -136.23 -75.25 83 12 TYR A 1205 ? ? 43.15 -89.01 84 12 GLN A 1207 ? ? -111.31 77.78 85 12 ALA A 1212 ? ? -159.21 30.24 86 12 VAL A 1213 ? ? -141.80 -46.26 87 13 SER A 1145 ? ? -177.15 134.87 88 13 LYS A 1147 ? ? 60.66 100.41 89 13 LYS A 1148 ? ? 62.91 120.57 90 13 GLN A 1157 ? ? -152.56 22.65 91 13 VAL A 1169 ? ? -144.67 -6.17 92 13 LYS A 1186 ? ? 23.25 82.61 93 13 TYR A 1205 ? ? 40.90 -90.22 94 13 LEU A 1206 ? ? -82.81 -75.61 95 13 GLN A 1207 ? ? -165.05 31.91 96 13 LYS A 1208 ? ? 59.19 106.70 97 13 ALA A 1212 ? ? -67.09 -175.26 98 14 LYS A 1147 ? ? 60.34 97.09 99 14 GLN A 1157 ? ? -155.63 26.71 100 14 VAL A 1169 ? ? -141.89 -12.12 101 14 ARG A 1182 ? ? -151.11 19.48 102 14 LYS A 1186 ? ? 14.66 62.44 103 14 SER A 1202 ? ? 52.88 -175.68 104 14 LYS A 1203 ? ? -163.33 31.11 105 14 TYR A 1205 ? ? -102.44 -167.10 106 14 LEU A 1206 ? ? 65.62 118.86 107 15 LYS A 1148 ? ? -66.88 -169.84 108 15 GLN A 1157 ? ? -154.50 22.93 109 15 VAL A 1169 ? ? -144.27 -5.09 110 15 LYS A 1186 ? ? 25.66 84.49 111 15 ALA A 1204 ? ? 70.71 87.59 112 15 LEU A 1206 ? ? 73.87 -19.38 113 15 GLN A 1207 ? ? -152.66 85.25 114 15 GLN A 1209 ? ? -59.97 172.05 115 16 GLN A 1157 ? ? -159.35 29.41 116 16 VAL A 1169 ? ? -142.46 -8.77 117 16 ARG A 1182 ? ? -150.07 15.92 118 16 LYS A 1186 ? ? 18.66 58.39 119 16 TYR A 1205 ? ? 40.71 -89.82 120 16 LEU A 1206 ? ? -77.92 -70.23 121 16 LYS A 1208 ? ? -58.62 -178.55 122 16 ALA A 1210 ? ? 59.74 178.54 123 16 VAL A 1213 ? ? -178.53 -39.08 124 17 LYS A 1147 ? ? 62.00 122.63 125 17 GLN A 1157 ? ? -157.27 27.81 126 17 VAL A 1169 ? ? -144.49 -6.68 127 17 ARG A 1182 ? ? -144.93 16.77 128 17 LYS A 1186 ? ? 14.63 80.81 129 17 TYR A 1205 ? ? -109.69 -166.39 130 17 LEU A 1206 ? ? 66.20 119.08 131 17 ALA A 1210 ? ? -176.49 -39.62 132 17 LYS A 1211 ? ? -162.98 101.65 133 17 ALA A 1212 ? ? 61.95 151.37 134 18 SER A 1145 ? ? -147.93 -52.81 135 18 VAL A 1146 ? ? -98.63 30.59 136 18 GLN A 1157 ? ? -154.56 23.59 137 18 VAL A 1169 ? ? -143.72 -4.76 138 18 ASN A 1183 ? ? -93.24 31.71 139 18 LYS A 1186 ? ? 28.49 86.12 140 18 SER A 1202 ? ? 57.62 -172.24 141 18 LYS A 1203 ? ? -163.38 -43.53 142 18 TYR A 1205 ? ? 41.25 -89.93 143 19 LYS A 1147 ? ? -67.56 -75.85 144 19 LYS A 1148 ? ? -145.69 -46.10 145 19 GLN A 1157 ? ? -153.48 22.33 146 19 VAL A 1169 ? ? -143.37 -9.55 147 19 ARG A 1182 ? ? -155.15 17.59 148 19 LYS A 1186 ? ? 22.02 62.70 149 19 LYS A 1208 ? ? 62.59 129.91 150 19 GLN A 1209 ? ? -146.72 -48.17 151 19 LYS A 1211 ? ? -176.51 135.01 152 19 ALA A 1212 ? ? 59.54 96.07 153 20 LYS A 1148 ? ? -160.96 -45.10 154 20 GLN A 1157 ? ? -153.73 24.13 155 20 ARG A 1182 ? ? -149.47 17.73 156 20 LYS A 1186 ? ? 21.34 80.90 157 20 TYR A 1205 ? ? 42.06 -94.22 158 20 LEU A 1206 ? ? 64.74 -15.16 159 20 ALA A 1210 ? ? 60.76 85.76 160 20 VAL A 1213 ? ? -136.89 -45.90 # _pdbx_entry_details.entry_id 2J2S _pdbx_entry_details.compound_details ;ENGINEERED RESIDUE IN CHAIN A, GLU 1143 TO GLY ENGINEERED RESIDUE IN CHAIN A, PRO 1144 TO GLY ENGINEERED RESIDUE IN CHAIN A, PRO 1145 TO SER ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;MUTATIONS AT THE N-TERMINUS ARE REQUIRED FOR REMOVAL OF FUSION PROTEIN. GLY 1143-SER 1145 REQUIRED FOR PURIFICATION. ; _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.entry_id 2J2S _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'NO VIOLATIONS' # _pdbx_nmr_representative.entry_id 2J2S _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER, 10% D2O' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 290.0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # _pdbx_nmr_details.entry_id 2J2S _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED CXXC DOMAIN' # _pdbx_nmr_refine.entry_id 2J2S _pdbx_nmr_refine.method CNS _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' ANSIG ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TRP N N N N 297 TRP CA C N S 298 TRP C C N N 299 TRP O O N N 300 TRP CB C N N 301 TRP CG C Y N 302 TRP CD1 C Y N 303 TRP CD2 C Y N 304 TRP NE1 N Y N 305 TRP CE2 C Y N 306 TRP CE3 C Y N 307 TRP CZ2 C Y N 308 TRP CZ3 C Y N 309 TRP CH2 C Y N 310 TRP OXT O N N 311 TRP H H N N 312 TRP H2 H N N 313 TRP HA H N N 314 TRP HB2 H N N 315 TRP HB3 H N N 316 TRP HD1 H N N 317 TRP HE1 H N N 318 TRP HE3 H N N 319 TRP HZ2 H N N 320 TRP HZ3 H N N 321 TRP HH2 H N N 322 TRP HXT H N N 323 TYR N N N N 324 TYR CA C N S 325 TYR C C N N 326 TYR O O N N 327 TYR CB C N N 328 TYR CG C Y N 329 TYR CD1 C Y N 330 TYR CD2 C Y N 331 TYR CE1 C Y N 332 TYR CE2 C Y N 333 TYR CZ C Y N 334 TYR OH O N N 335 TYR OXT O N N 336 TYR H H N N 337 TYR H2 H N N 338 TYR HA H N N 339 TYR HB2 H N N 340 TYR HB3 H N N 341 TYR HD1 H N N 342 TYR HD2 H N N 343 TYR HE1 H N N 344 TYR HE2 H N N 345 TYR HH H N N 346 TYR HXT H N N 347 VAL N N N N 348 VAL CA C N S 349 VAL C C N N 350 VAL O O N N 351 VAL CB C N N 352 VAL CG1 C N N 353 VAL CG2 C N N 354 VAL OXT O N N 355 VAL H H N N 356 VAL H2 H N N 357 VAL HA H N N 358 VAL HB H N N 359 VAL HG11 H N N 360 VAL HG12 H N N 361 VAL HG13 H N N 362 VAL HG21 H N N 363 VAL HG22 H N N 364 VAL HG23 H N N 365 VAL HXT H N N 366 ZN ZN ZN N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AMX Bruker 500 ? 2 AVANCE Bruker 800 ? 3 AVANCE Bruker 600 ? # _atom_sites.entry_id 2J2S _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #