data_2J52 # _entry.id 2J52 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2J52 PDBE EBI-29735 WWPDB D_1290029735 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1EM7 unspecified 'HELIX VARIANT OF THE B1 DOMAIN FROM STREPTOCOCCAL PROTEIN G' PDB 1GB1 unspecified . PDB 1IGC unspecified 'IGG1 FAB FRAGMENT (MOPC21) COMPLEX WITH DOMAIN III OF 1IGC 3PROTEIN G FROM STREPTOCOCCUS 1IGC 4' PDB 1IGD unspecified . PDB 1LE3 unspecified 'NMR STRUCTURE OF TRYPTOPHAN ZIPPER 4: A STABLE BETA-HAIRPINPEPTIDE BASED ON THE C- TERMINAL HAIRPIN OF THE B1 DOMAINOF PROTEIN G' PDB 1MPE unspecified 'ENSEMBLE OF 20 STRUCTURES OF THE TETRAMERIC MUTANT OF THEB1 DOMAIN OF STREPTOCOCCAL PROTEIN G' PDB 1MVK unspecified 'X-RAY STRUCTURE OF THE TETRAMERIC MUTANT OF THE B1 DOMAINOF STREPTOCOCCAL PROTEIN G' PDB 1PGA unspecified . PDB 1PGB unspecified . PDB 1PGX unspecified . PDB 1PN5 unspecified 'NMR STRUCTURE OF THE NALP1 PYRIN DOMAIN ( PYD)' PDB 1Q10 unspecified 'ENSEMBLE OF 40 STRUCTURES OF THE DIMERIC MUTANT OF THE B1DOMAIN OF STREPTOCOCCAL PROTEIN G' PDB 2GB1 unspecified . PDB 2IGD unspecified 'ANISOTROPIC STRUCTURE OF PROTEIN G IGG- BINDING DOMAIN IIIAT 1.1 ANGSTROM RESOLUTION' PDB 2IGH unspecified . PDB 2J53 unspecified 'SOLUTION STRUCTURE OF GB1 DOMAIN PROTEIN G AND LOW AND HIGH PRESSURE.' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2J52 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-09-11 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wilton, D.J.' 1 'Tunnicliffe, R.B.' 2 'Kamatari, Y.O.' 3 'Akasaka, K.' 4 'Williamson, M.P.' 5 # _citation.id primary _citation.title 'Pressure-Induced Changes in the Solution Structure of the Gb1 Domain of Protein G.' _citation.journal_abbrev Proteins _citation.journal_volume 71 _citation.page_first 1432 _citation.page_last ? _citation.year 2008 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18076052 _citation.pdbx_database_id_DOI 10.1002/PROT.21832 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wilton, D.J.' 1 primary 'Tunnicliffe, R.B.' 2 primary 'Kamatari, Y.O.' 3 primary 'Akasaka, K.' 4 primary 'Williamson, M.P.' 5 # _cell.entry_id 2J52 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2J52 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'IMMUNOGLOBULIN G-BINDING PROTEIN G' _entity.formula_weight 6157.773 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation YES _entity.pdbx_fragment 'RESIDUES 228-282' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PROTEIN G, IGG-BINDING PROTEIN G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDAATKTFTVTE _entity_poly.pdbx_seq_one_letter_code_can MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDAATKTFTVTE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 TYR n 1 4 LYS n 1 5 LEU n 1 6 ILE n 1 7 LEU n 1 8 ASN n 1 9 GLY n 1 10 LYS n 1 11 THR n 1 12 LEU n 1 13 LYS n 1 14 GLY n 1 15 GLU n 1 16 THR n 1 17 THR n 1 18 THR n 1 19 GLU n 1 20 ALA n 1 21 VAL n 1 22 ASP n 1 23 ALA n 1 24 ALA n 1 25 THR n 1 26 ALA n 1 27 GLU n 1 28 LYS n 1 29 VAL n 1 30 PHE n 1 31 LYS n 1 32 GLN n 1 33 TYR n 1 34 ALA n 1 35 ASN n 1 36 ASP n 1 37 ASN n 1 38 GLY n 1 39 VAL n 1 40 ASP n 1 41 GLY n 1 42 GLU n 1 43 TRP n 1 44 THR n 1 45 TYR n 1 46 ASP n 1 47 ALA n 1 48 ALA n 1 49 THR n 1 50 LYS n 1 51 THR n 1 52 PHE n 1 53 THR n 1 54 VAL n 1 55 THR n 1 56 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'STREPTOCOCCUS SP.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1306 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2J52 1 ? ? 2J52 ? 2 UNP SPG1_STRSG 1 ? ? P06654 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2J52 A 1 ? 1 ? 2J52 1 ? 1 ? 1 1 2 2 2J52 A 2 ? 56 ? P06654 228 ? 282 ? 2 56 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2J52 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 47 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P06654 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 273 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 47 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type HSQC _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 287.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 30.0 _pdbx_nmr_exptl_sample_conditions.pH 5.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 90%WATER/10%D2O # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 750 # _pdbx_nmr_refine.entry_id 2J52 _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details 'THIS STRUCTURE IS FOR COMPARISON WITH THE ACCOMPANYING HIGH PRESSURE STRUCTURE (2J53)' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2J52 _pdbx_nmr_details.text NONE # _pdbx_nmr_ensemble.entry_id 2J52 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'MINIMIZED AVERAGE' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR 3.1 ? 2 # _exptl.entry_id 2J52 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2J52 _struct.title 'Solution Structure of GB1 domain Protein G and low and high pressure.' _struct.pdbx_descriptor 'IMMUNOGLOBULIN G-BINDING PROTEIN G' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 2J52 _struct_keywords.pdbx_keywords IMMUNOGLOBULIN _struct_keywords.text 'PEPTIDOGLYCAN-ANCHOR, IMMUNOGLOBULIN, PRESSURE, CELL WALL, PROTEIN G, IGG-BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 22 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 37 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 22 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 37 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? parallel AA 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LYS A 13 ? THR A 18 ? LYS A 13 THR A 18 AA 2 TYR A 3 ? ASN A 8 ? TYR A 3 ASN A 8 AA 3 THR A 51 ? THR A 55 ? THR A 51 THR A 55 AA 4 GLU A 42 ? TYR A 45 ? GLU A 42 TYR A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N THR A 18 ? N THR A 18 O TYR A 3 ? O TYR A 3 AA 2 3 N ILE A 6 ? N ILE A 6 O PHE A 52 ? O PHE A 52 AA 3 4 N THR A 55 ? N THR A 55 O GLU A 42 ? O GLU A 42 # _database_PDB_matrix.entry_id 2J52 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2J52 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-25 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_entry_details.entry_id 2J52 _pdbx_entry_details.compound_details 'ENGINEERED RESIDUE IN CHAIN A, ASP 273 TO ALA' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'SUBSTITUTE D273A' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH A TYR 3 ? ? HZ2 A LYS 50 ? ? 1.32 2 1 O A GLY 9 ? ? HZ1 A LYS 13 ? ? 1.33 3 1 O A ALA 24 ? ? HZ1 A LYS 28 ? ? 1.34 4 1 OE2 A GLU 27 ? ? HZ1 A LYS 31 ? ? 1.35 5 1 OE1 A GLU 27 ? ? HZ3 A LYS 28 ? ? 1.38 6 1 H2 A MET 1 ? ? O A ALA 20 ? ? 1.38 7 1 HZ3 A LYS 10 ? ? OXT A GLU 56 ? ? 1.38 8 1 O A LYS 10 ? ? HZ2 A LYS 13 ? ? 1.43 9 1 HZ2 A LYS 4 ? ? OE1 A GLU 15 ? ? 1.44 10 1 HG1 A THR 44 ? ? OG1 A THR 53 ? ? 1.45 11 1 OD2 A ASP 46 ? ? H A THR 49 ? ? 1.46 12 1 H A GLU 42 ? ? O A THR 55 ? ? 1.49 13 1 HH A TYR 33 ? ? OD1 A ASN 37 ? ? 1.50 14 1 O A THR 44 ? ? HG1 A THR 53 ? ? 1.51 15 1 O A VAL 54 ? ? HG1 A THR 55 ? ? 1.51 16 1 OD1 A ASP 22 ? ? H A THR 25 ? ? 1.52 17 1 O A GLU 27 ? ? H A LYS 31 ? ? 1.53 18 1 OD2 A ASP 40 ? ? HE1 A TRP 43 ? ? 1.54 19 1 O A GLN 32 ? ? H A ASP 36 ? ? 1.56 20 1 H A LYS 10 ? ? OE1 A GLU 56 ? ? 1.57 21 1 HE21 A GLN 32 ? ? OD1 A ASP 36 ? ? 1.57 22 1 O A ALA 34 ? ? H A VAL 39 ? ? 1.57 23 1 O A LYS 4 ? ? H A PHE 52 ? ? 1.57 24 1 OD1 A ASP 40 ? ? H A GLY 41 ? ? 1.59 25 1 H1 A MET 1 ? ? OE2 A GLU 19 ? ? 1.60 26 1 OD2 A ASP 46 ? ? HG1 A THR 49 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 18 ? ? -171.56 -177.35 2 1 ALA A 20 ? ? -175.85 149.58 3 1 ASP A 22 ? ? -109.55 -159.44 4 1 ASP A 40 ? ? -169.68 -143.77 5 1 LYS A 50 ? ? 55.78 19.29 #