data_2J7I # _entry.id 2J7I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2J7I PDBE EBI-29388 WWPDB D_1290029388 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1CDB unspecified . PDB 1GYA unspecified 'N-GLYCAN AND POLYPEPTIDE NMR SOLUTION STRUCTURES OF THE ADHESION DOMAIN OF HUMAN CD2' PDB 1HNF unspecified 'CD2 (HUMAN)' PDB 1L2Z unspecified 'CD2BP2-GYF DOMAIN IN COMPLEX WITH PROLINE- RICH CD2 TAILSEGMENT PEPTIDE' PDB 2BZ8 unspecified 'N-TERMINAL SH3 DOMAIN OF CIN85 BOUND TO CBL-B PEPTIDE' PDB 2J6F unspecified 'N-TERMINAL SH3 DOMAIN OF CMS (CD2AP HUMAN HOMOLOG) BOUND TO CBL-B PEPTIDE' PDB 2J6K unspecified 'N-TERMINAL SH3 DOMAIN OF CMS (CD2AP HUMAN HOMOLOG)' PDB 2J6O unspecified 'ATYPICAL POLYPROLINE RECOGNITION BY THE CMS N-TERMINAL SH3 DOMAIN. CMS:CD2 HETEROTRIMER' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2J7I _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-10-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Moncalian, G.' 1 'Cardenes, N.' 2 'Deribe, Y.L.' 3 'Spinola-Amilibia, M.' 4 'Dikic, I.' 5 'Bravo, J.' 6 # _citation.id primary _citation.title 'Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 281 _citation.page_first 38845 _citation.page_last ? _citation.year 2006 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17020880 _citation.pdbx_database_id_DOI 10.1074/JBC.M606411200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Moncalian, G.' 1 primary 'Cardenes, N.' 2 primary 'Deribe, Y.L.' 3 primary 'Spinola-Amilibia, M.' 4 primary 'Dikic, I.' 5 primary 'Bravo, J.' 6 # _cell.entry_id 2J7I _cell.length_a 36.319 _cell.length_b 59.719 _cell.length_c 70.867 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2J7I _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CD2-ASSOCIATED PROTEIN' 7412.285 2 ? ? 'SH3 DOMAIN, RESIDUES 1-62' 'N-TERMINAL SH3 DOMAIN FROM CMS (CAS LIGAND WITH MULTIPLE SH3 DOMAINS) OR CD2AP (CD2-ASSOCIATED PROTEIN)' 2 polymer syn 'T-CELL SURFACE ANTIGEN CD2' 1119.382 2 ? ? 'CMS BINDING SEQUENCE, RESIDUES 324-333' ? 3 water nat water 18.015 31 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'CAS LIGAND WITH MULTIPLE SH3 DOMAINS, ADAPTER PROTEIN CMS, CMS' 2 'T-CELL SURFACE ANTIGEN T11/LEU-5, LFA-2, LFA-3 RECEPTOR, ERYTHROCYTE RECEPTOR, ROSETTE RECEPTOR, CD2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETE MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETE A,B ? 2 'polypeptide(L)' no no KGPPLPRPRV KGPPLPRPRV C,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ASP n 1 4 TYR n 1 5 ILE n 1 6 VAL n 1 7 GLU n 1 8 TYR n 1 9 ASP n 1 10 TYR n 1 11 ASP n 1 12 ALA n 1 13 VAL n 1 14 HIS n 1 15 ASP n 1 16 ASP n 1 17 GLU n 1 18 LEU n 1 19 THR n 1 20 ILE n 1 21 ARG n 1 22 VAL n 1 23 GLY n 1 24 GLU n 1 25 ILE n 1 26 ILE n 1 27 ARG n 1 28 ASN n 1 29 VAL n 1 30 LYS n 1 31 LYS n 1 32 LEU n 1 33 GLN n 1 34 GLU n 1 35 GLU n 1 36 GLY n 1 37 TRP n 1 38 LEU n 1 39 GLU n 1 40 GLY n 1 41 GLU n 1 42 LEU n 1 43 ASN n 1 44 GLY n 1 45 ARG n 1 46 ARG n 1 47 GLY n 1 48 MET n 1 49 PHE n 1 50 PRO n 1 51 ASP n 1 52 ASN n 1 53 PHE n 1 54 VAL n 1 55 LYS n 1 56 GLU n 1 57 ILE n 1 58 LYS n 1 59 ARG n 1 60 GLU n 1 61 THR n 1 62 GLU n 2 1 LYS n 2 2 GLY n 2 3 PRO n 2 4 PRO n 2 5 LEU n 2 6 PRO n 2 7 ARG n 2 8 PRO n 2 9 ARG n 2 10 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'ROSSETTA (DE3) PLYS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET 21A' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'HOMO SAPIENS' _pdbx_entity_src_syn.organism_common_name HUMAN _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP CD2AP_HUMAN 1 ? ? Q9Y5K6 ? 2 UNP CD2_HUMAN 2 ? ? P06729 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2J7I A 1 ? 62 ? Q9Y5K6 1 ? 62 ? 1 62 2 1 2J7I B 1 ? 62 ? Q9Y5K6 1 ? 62 ? 1 62 3 2 2J7I C 1 ? 10 ? P06729 324 ? 333 ? 324 333 4 2 2J7I D 1 ? 10 ? P06729 324 ? 333 ? 324 333 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2J7I _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.6 _exptl_crystal.density_percent_sol 52.2 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '30% PEG8000, 0.2M NACL, 0.1M TRIS-HCL PH 8.0' # _diffrn.id 1 _diffrn.ambient_temp 110.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESERACH _diffrn_detector.pdbx_collection_date 2004-06-08 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54179 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'ENRAF-NONIUS FR591' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.54179 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2J7I _reflns.observed_criterion_sigma_I 2.400 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 36.290 _reflns.d_resolution_high 2.900 _reflns.number_obs 3729 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.10000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 22.0000 _reflns.B_iso_Wilson_estimate 49.9 _reflns.pdbx_redundancy 8.000 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.10 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.31000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.200 _reflns_shell.pdbx_redundancy 8.10 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2J7I _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 3690 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 590838.33 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.80 _refine.ls_d_res_high 2.90 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.248 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.248 _refine.ls_R_factor_R_free 0.295 _refine.ls_R_factor_R_free_error 0.022 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 184 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 38.2 _refine.aniso_B[1][1] 5.69 _refine.aniso_B[2][2] -20.39 _refine.aniso_B[3][3] 14.70 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.320003 _refine.solvent_model_param_bsol 24.9924 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'CMSA-CBL-B STRUCTURE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 2J7I _refine_analyze.Luzzati_coordinate_error_obs 0.39 _refine_analyze.Luzzati_sigma_a_obs 0.46 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.43 _refine_analyze.Luzzati_sigma_a_free 0.46 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1111 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 1142 _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 19.80 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.36 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 5.16 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 7.74 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 8.21 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 11.72 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.90 _refine_ls_shell.d_res_low 3.08 _refine_ls_shell.number_reflns_R_work 581 _refine_ls_shell.R_factor_R_work 0.341 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.313 _refine_ls_shell.R_factor_R_free_error 0.076 _refine_ls_shell.percent_reflns_R_free 2.8 _refine_ls_shell.number_reflns_R_free 17 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM ? # _struct.entry_id 2J7I _struct.title 'ATYPICAL POLYPROLINE RECOGNITION BY THE CMS N-TERMINAL SH3 DOMAIN. CMS:CD2 HETERODIMER' _struct.pdbx_descriptor 'CD2-ASSOCIATED PROTEIN, T-CELL SURFACE ANTIGEN CD2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2J7I _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;COILED COIL, POLYMORPHISM, GLYCOPROTEIN, CELL ADHESION, EGFR DOWNREGULATION, IMMUNOGLOBULIN DOMAIN, TRANSMEMBRANE, PHOSPHORYLATION, ADAPTOR PROTEIN, CMS, CD2AD, MEMBRANE, SH3 DOMAIN, SH3-BINDING, SH3 DOMAIN RECOGNITION, PROTEIN BINDING ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? BA ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel BA 1 2 ? anti-parallel BA 2 3 ? anti-parallel BA 3 4 ? anti-parallel BA 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ARG A 46 ? PRO A 50 ? ARG A 46 PRO A 50 AA 2 TRP A 37 ? GLU A 41 ? TRP A 37 GLU A 41 AA 3 ILE A 25 ? LYS A 31 ? ILE A 25 LYS A 31 AA 4 TYR A 4 ? VAL A 6 ? TYR A 4 VAL A 6 AA 5 VAL A 54 ? GLU A 56 ? VAL A 54 GLU A 56 BA 1 ARG B 45 ? PRO B 50 ? ARG B 45 PRO B 50 BA 2 TRP B 37 ? LEU B 42 ? TRP B 37 LEU B 42 BA 3 ILE B 25 ? LYS B 30 ? ILE B 25 LYS B 30 BA 4 ASP B 3 ? VAL B 6 ? ASP B 3 VAL B 6 BA 5 VAL B 54 ? GLU B 56 ? VAL B 54 GLU B 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N PHE A 49 ? N PHE A 49 O LEU A 38 ? O LEU A 38 AA 2 3 N GLU A 41 ? N GLU A 41 O ARG A 27 ? O ARG A 27 AA 3 4 N ILE A 26 ? N ILE A 26 O TYR A 4 ? O TYR A 4 AA 4 5 N ILE A 5 ? N ILE A 5 O LYS A 55 ? O LYS A 55 BA 1 2 N PHE B 49 ? N PHE B 49 O LEU B 38 ? O LEU B 38 BA 2 3 N GLU B 41 ? N GLU B 41 O ARG B 27 ? O ARG B 27 BA 3 4 N ILE B 26 ? N ILE B 26 O TYR B 4 ? O TYR B 4 BA 4 5 N ILE B 5 ? N ILE B 5 O LYS B 55 ? O LYS B 55 # _database_PDB_matrix.entry_id 2J7I _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2J7I _atom_sites.fract_transf_matrix[1][1] 0.027534 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016745 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014111 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLU 60 60 ? ? ? A . n A 1 61 THR 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 VAL 2 2 2 VAL VAL B . n B 1 3 ASP 3 3 3 ASP ASP B . n B 1 4 TYR 4 4 4 TYR TYR B . n B 1 5 ILE 5 5 5 ILE ILE B . n B 1 6 VAL 6 6 6 VAL VAL B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 TYR 8 8 8 TYR TYR B . n B 1 9 ASP 9 9 9 ASP ASP B . n B 1 10 TYR 10 10 10 TYR TYR B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 VAL 13 13 13 VAL VAL B . n B 1 14 HIS 14 14 14 HIS HIS B . n B 1 15 ASP 15 15 15 ASP ASP B . n B 1 16 ASP 16 16 16 ASP ASP B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 THR 19 19 19 THR THR B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 GLY 23 23 23 GLY GLY B . n B 1 24 GLU 24 24 24 GLU GLU B . n B 1 25 ILE 25 25 25 ILE ILE B . n B 1 26 ILE 26 26 26 ILE ILE B . n B 1 27 ARG 27 27 27 ARG ARG B . n B 1 28 ASN 28 28 28 ASN ASN B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 GLN 33 33 33 GLN GLN B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 GLY 36 36 36 GLY GLY B . n B 1 37 TRP 37 37 37 TRP TRP B . n B 1 38 LEU 38 38 38 LEU LEU B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 LEU 42 42 42 LEU LEU B . n B 1 43 ASN 43 43 43 ASN ASN B . n B 1 44 GLY 44 44 44 GLY GLY B . n B 1 45 ARG 45 45 45 ARG ARG B . n B 1 46 ARG 46 46 46 ARG ARG B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 MET 48 48 48 MET MET B . n B 1 49 PHE 49 49 49 PHE PHE B . n B 1 50 PRO 50 50 50 PRO PRO B . n B 1 51 ASP 51 51 51 ASP ASP B . n B 1 52 ASN 52 52 52 ASN ASN B . n B 1 53 PHE 53 53 53 PHE PHE B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 GLU 56 56 56 GLU GLU B . n B 1 57 ILE 57 57 57 ILE ILE B . n B 1 58 LYS 58 58 58 LYS LYS B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 GLU 60 60 ? ? ? B . n B 1 61 THR 61 61 ? ? ? B . n B 1 62 GLU 62 62 ? ? ? B . n C 2 1 LYS 1 324 ? ? ? C . n C 2 2 GLY 2 325 325 GLY GLY C . n C 2 3 PRO 3 326 326 PRO PRO C . n C 2 4 PRO 4 327 327 PRO PRO C . n C 2 5 LEU 5 328 328 LEU LEU C . n C 2 6 PRO 6 329 329 PRO PRO C . n C 2 7 ARG 7 330 330 ARG ARG C . n C 2 8 PRO 8 331 331 PRO PRO C . n C 2 9 ARG 9 332 332 ARG ARG C . n C 2 10 VAL 10 333 333 VAL VAL C . n D 2 1 LYS 1 324 324 LYS LYS D . n D 2 2 GLY 2 325 325 GLY GLY D . n D 2 3 PRO 3 326 326 PRO PRO D . n D 2 4 PRO 4 327 327 PRO PRO D . n D 2 5 LEU 5 328 328 LEU LEU D . n D 2 6 PRO 6 329 329 PRO PRO D . n D 2 7 ARG 7 330 330 ARG ARG D . n D 2 8 PRO 8 331 331 PRO PRO D . n D 2 9 ARG 9 332 332 ARG ARG D . n D 2 10 VAL 10 333 333 VAL VAL D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 2001 2001 HOH HOH A . E 3 HOH 2 2002 2002 HOH HOH A . E 3 HOH 3 2003 2003 HOH HOH A . E 3 HOH 4 2004 2004 HOH HOH A . E 3 HOH 5 2005 2005 HOH HOH A . E 3 HOH 6 2006 2006 HOH HOH A . E 3 HOH 7 2007 2007 HOH HOH A . E 3 HOH 8 2008 2008 HOH HOH A . E 3 HOH 9 2009 2009 HOH HOH A . E 3 HOH 10 2010 2010 HOH HOH A . E 3 HOH 11 2011 2011 HOH HOH A . E 3 HOH 12 2012 2012 HOH HOH A . E 3 HOH 13 2013 2013 HOH HOH A . E 3 HOH 14 2014 2014 HOH HOH A . E 3 HOH 15 2015 2015 HOH HOH A . E 3 HOH 16 2016 2016 HOH HOH A . E 3 HOH 17 2017 2017 HOH HOH A . F 3 HOH 1 2001 2001 HOH HOH B . F 3 HOH 2 2002 2002 HOH HOH B . F 3 HOH 3 2003 2003 HOH HOH B . F 3 HOH 4 2004 2004 HOH HOH B . F 3 HOH 5 2005 2005 HOH HOH B . F 3 HOH 6 2006 2006 HOH HOH B . F 3 HOH 7 2007 2007 HOH HOH B . F 3 HOH 8 2008 2008 HOH HOH B . F 3 HOH 9 2009 2009 HOH HOH B . F 3 HOH 10 2010 2010 HOH HOH B . F 3 HOH 11 2011 2011 HOH HOH B . F 3 HOH 12 2012 2012 HOH HOH B . G 3 HOH 1 2001 2001 HOH HOH C . G 3 HOH 2 2002 2002 HOH HOH C . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PQS dimeric 2 2 author_and_software_defined_assembly PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E,G 2 1 B,D,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-06 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-07-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category diffrn_source # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_diffrn_source.type' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 AMoRE phasing . ? 4 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CD D LYS 324 ? ? 1_555 CG1 D VAL 333 ? ? 4_556 1.38 2 1 CE D LYS 324 ? ? 1_555 CG1 D VAL 333 ? ? 4_556 1.66 3 1 CG D LYS 324 ? ? 1_555 CG1 D VAL 333 ? ? 4_556 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 C _pdbx_validate_rmsd_angle.auth_comp_id_1 PRO _pdbx_validate_rmsd_angle.auth_seq_id_1 326 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 C _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 327 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 C _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 327 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.77 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.47 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? -5.26 100.49 2 1 VAL A 54 ? ? -135.91 -158.76 3 1 LYS A 58 ? ? 168.61 163.22 4 1 LYS B 58 ? ? -125.54 -117.77 5 1 PRO C 326 ? ? -49.27 104.32 6 1 PRO C 327 ? ? -35.74 145.37 7 1 ARG D 332 ? ? -103.27 -152.36 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 59 ? CA ? A ARG 59 CA 2 1 Y 1 A ARG 59 ? C ? A ARG 59 C 3 1 Y 1 A ARG 59 ? O ? A ARG 59 O 4 1 Y 1 A ARG 59 ? CB ? A ARG 59 CB 5 1 Y 1 A ARG 59 ? CG ? A ARG 59 CG 6 1 Y 1 A ARG 59 ? CD ? A ARG 59 CD 7 1 Y 1 A ARG 59 ? NE ? A ARG 59 NE 8 1 Y 1 A ARG 59 ? CZ ? A ARG 59 CZ 9 1 Y 1 A ARG 59 ? NH1 ? A ARG 59 NH1 10 1 Y 1 A ARG 59 ? NH2 ? A ARG 59 NH2 11 1 Y 1 B ARG 59 ? CA ? B ARG 59 CA 12 1 Y 1 B ARG 59 ? C ? B ARG 59 C 13 1 Y 1 B ARG 59 ? O ? B ARG 59 O 14 1 Y 1 B ARG 59 ? CB ? B ARG 59 CB 15 1 Y 1 B ARG 59 ? CG ? B ARG 59 CG 16 1 Y 1 B ARG 59 ? CD ? B ARG 59 CD 17 1 Y 1 B ARG 59 ? NE ? B ARG 59 NE 18 1 Y 1 B ARG 59 ? CZ ? B ARG 59 CZ 19 1 Y 1 B ARG 59 ? NH1 ? B ARG 59 NH1 20 1 Y 1 B ARG 59 ? NH2 ? B ARG 59 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 60 ? A GLU 60 2 1 Y 1 A THR 61 ? A THR 61 3 1 Y 1 A GLU 62 ? A GLU 62 4 1 Y 1 B MET 1 ? B MET 1 5 1 Y 1 B GLU 60 ? B GLU 60 6 1 Y 1 B THR 61 ? B THR 61 7 1 Y 1 B GLU 62 ? B GLU 62 8 1 Y 1 C LYS 324 ? C LYS 1 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #