data_2JD3 # _entry.id 2JD3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2JD3 PDBE EBI-30993 WWPDB D_1290030993 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2JD3 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2007-01-04 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Moller-Jensen, J.' 1 'Lowe, J.' 2 # _citation.id primary _citation.title 'Structural Analysis of the Parr/Parc Plasmid Partition Complex.' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 26 _citation.page_first 4413 _citation.page_last ? _citation.year 2007 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17898804 _citation.pdbx_database_id_DOI 10.1038/SJ.EMBOJ.7601864 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Moller-Jensen, J.' 1 primary 'Ringgaard, S.' 2 primary 'Mercogliano, C.P.' 3 primary 'Gerdes, K.' 4 primary 'Lowe, J.' 5 # _cell.entry_id 2JD3 _cell.length_a 96.768 _cell.length_b 96.768 _cell.length_c 124.945 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JD3 _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'STBB PROTEIN' 14668.773 2 ? ? ? ? 2 water nat water 18.015 26 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PARR, STABILITY PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDDERKRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQ TTGWKPSQADIRAVLTELGASQSVEKMPPSATDSVQEAMNDVRLKMKKLF ; _entity_poly.pdbx_seq_one_letter_code_can ;MDDERKRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQ TTGWKPSQADIRAVLTELGASQSVEKMPPSATDSVQEAMNDVRLKMKKLF ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASP n 1 4 GLU n 1 5 ARG n 1 6 LYS n 1 7 ARG n 1 8 LYS n 1 9 LYS n 1 10 TYR n 1 11 THR n 1 12 LEU n 1 13 TYR n 1 14 LEU n 1 15 HIS n 1 16 PRO n 1 17 GLU n 1 18 LYS n 1 19 ALA n 1 20 ALA n 1 21 ASP n 1 22 PHE n 1 23 GLN n 1 24 THR n 1 25 LEU n 1 26 GLU n 1 27 ALA n 1 28 ILE n 1 29 GLU n 1 30 SER n 1 31 VAL n 1 32 PRO n 1 33 ARG n 1 34 SER n 1 35 GLU n 1 36 ARG n 1 37 GLY n 1 38 GLU n 1 39 LEU n 1 40 PHE n 1 41 ARG n 1 42 ASN n 1 43 ALA n 1 44 PHE n 1 45 ILE n 1 46 SER n 1 47 GLY n 1 48 MET n 1 49 ALA n 1 50 LEU n 1 51 HIS n 1 52 GLN n 1 53 LEU n 1 54 ASP n 1 55 PRO n 1 56 ARG n 1 57 LEU n 1 58 PRO n 1 59 VAL n 1 60 LEU n 1 61 LEU n 1 62 THR n 1 63 ALA n 1 64 ILE n 1 65 LEU n 1 66 SER n 1 67 GLU n 1 68 GLU n 1 69 PHE n 1 70 SER n 1 71 ALA n 1 72 ASP n 1 73 GLN n 1 74 VAL n 1 75 VAL n 1 76 THR n 1 77 LEU n 1 78 LEU n 1 79 SER n 1 80 GLN n 1 81 THR n 1 82 THR n 1 83 GLY n 1 84 TRP n 1 85 LYS n 1 86 PRO n 1 87 SER n 1 88 GLN n 1 89 ALA n 1 90 ASP n 1 91 ILE n 1 92 ARG n 1 93 ALA n 1 94 VAL n 1 95 LEU n 1 96 THR n 1 97 GLU n 1 98 LEU n 1 99 GLY n 1 100 ALA n 1 101 SER n 1 102 GLN n 1 103 SER n 1 104 VAL n 1 105 GLU n 1 106 LYS n 1 107 MET n 1 108 PRO n 1 109 PRO n 1 110 SER n 1 111 ALA n 1 112 THR n 1 113 ASP n 1 114 SER n 1 115 VAL n 1 116 GLN n 1 117 GLU n 1 118 ALA n 1 119 MET n 1 120 ASN n 1 121 ASP n 1 122 VAL n 1 123 ARG n 1 124 LEU n 1 125 LYS n 1 126 MET n 1 127 LYS n 1 128 LYS n 1 129 LEU n 1 130 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'PLASMID PB171 (ORF 67)' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9S101_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9S101 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2JD3 A 1 ? 130 ? Q9S101 1 ? 130 ? 1 130 2 1 2JD3 B 1 ? 130 ? Q9S101 1 ? 130 ? 1 130 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2JD3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_percent_sol 58 _exptl_crystal.description NONE # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2005-09-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.931 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-3' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-3 _diffrn_source.pdbx_wavelength 0.931 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2JD3 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 2.80 _reflns.number_obs 9015 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 23.30 _reflns.B_iso_Wilson_estimate 80.11 _reflns.pdbx_redundancy 11.6 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.80 _reflns_shell.d_res_low 2.95 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.46 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.30 _reflns_shell.pdbx_redundancy 12.0 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2JD3 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8997 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.0 _refine.ls_d_res_high 2.8 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.2394 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2394 _refine.ls_R_factor_R_free 0.2767 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 469 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 54.9 _refine.aniso_B[1][1] -0.332 _refine.aniso_B[2][2] -0.332 _refine.aniso_B[3][3] 0.664 _refine.aniso_B[1][2] -10.149 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol 0.321467 _refine.solvent_model_param_bsol 31.7018 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1434 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 1460 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low 50.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.347 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.d_res_high 2.8 _refine_ls_shell.d_res_low 2.91 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.3787 _refine_ls_shell.percent_reflns_obs 99.9 _refine_ls_shell.R_factor_R_free 0.4538 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5 _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM ? 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM ? 'X-RAY DIFFRACTION' 3 ION.PARAM ? # _struct.entry_id 2JD3 _struct.title 'ParR from plasmid pB171' _struct.pdbx_descriptor 'STBB PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JD3 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'PLASMID SEGREGATION, ACTIN-LIKE FILAMENTS, RHH2, PARM, PLASMID, DNA BINDING, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 18 ? SER A 30 ? LYS A 18 SER A 30 1 ? 13 HELX_P HELX_P2 2 PRO A 32 ? ASP A 54 ? PRO A 32 ASP A 54 1 ? 23 HELX_P HELX_P3 3 PRO A 55 ? LEU A 65 ? PRO A 55 LEU A 65 1 ? 11 HELX_P HELX_P4 4 SER A 70 ? GLY A 83 ? SER A 70 GLY A 83 1 ? 14 HELX_P HELX_P5 5 GLN A 88 ? VAL A 94 ? GLN A 88 VAL A 94 1 ? 7 HELX_P HELX_P6 6 LYS B 18 ? SER B 30 ? LYS B 18 SER B 30 1 ? 13 HELX_P HELX_P7 7 PRO B 32 ? ASP B 54 ? PRO B 32 ASP B 54 1 ? 23 HELX_P HELX_P8 8 PRO B 55 ? LEU B 65 ? PRO B 55 LEU B 65 1 ? 11 HELX_P HELX_P9 9 SER B 70 ? GLY B 83 ? SER B 70 GLY B 83 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LYS A 8 ? LEU A 14 ? LYS A 8 LEU A 14 AA 2 LYS B 8 ? LEU B 14 ? LYS B 8 LEU B 14 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 14 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 14 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 8 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 8 # _database_PDB_matrix.entry_id 2JD3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2JD3 _atom_sites.fract_transf_matrix[1][1] 0.010334 _atom_sites.fract_transf_matrix[1][2] 0.005966 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011933 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008004 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLU 97 97 ? ? ? A . n A 1 98 LEU 98 98 ? ? ? A . n A 1 99 GLY 99 99 ? ? ? A . n A 1 100 ALA 100 100 ? ? ? A . n A 1 101 SER 101 101 ? ? ? A . n A 1 102 GLN 102 102 ? ? ? A . n A 1 103 SER 103 103 ? ? ? A . n A 1 104 VAL 104 104 ? ? ? A . n A 1 105 GLU 105 105 ? ? ? A . n A 1 106 LYS 106 106 ? ? ? A . n A 1 107 MET 107 107 ? ? ? A . n A 1 108 PRO 108 108 ? ? ? A . n A 1 109 PRO 109 109 ? ? ? A . n A 1 110 SER 110 110 ? ? ? A . n A 1 111 ALA 111 111 ? ? ? A . n A 1 112 THR 112 112 ? ? ? A . n A 1 113 ASP 113 113 ? ? ? A . n A 1 114 SER 114 114 ? ? ? A . n A 1 115 VAL 115 115 ? ? ? A . n A 1 116 GLN 116 116 ? ? ? A . n A 1 117 GLU 117 117 ? ? ? A . n A 1 118 ALA 118 118 ? ? ? A . n A 1 119 MET 119 119 ? ? ? A . n A 1 120 ASN 120 120 ? ? ? A . n A 1 121 ASP 121 121 ? ? ? A . n A 1 122 VAL 122 122 ? ? ? A . n A 1 123 ARG 123 123 ? ? ? A . n A 1 124 LEU 124 124 ? ? ? A . n A 1 125 LYS 125 125 ? ? ? A . n A 1 126 MET 126 126 ? ? ? A . n A 1 127 LYS 127 127 ? ? ? A . n A 1 128 LYS 128 128 ? ? ? A . n A 1 129 LEU 129 129 ? ? ? A . n A 1 130 PHE 130 130 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ASP 2 2 ? ? ? B . n B 1 3 ASP 3 3 ? ? ? B . n B 1 4 GLU 4 4 ? ? ? B . n B 1 5 ARG 5 5 ? ? ? B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 ARG 7 7 7 ARG ARG B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 TYR 10 10 10 TYR TYR B . n B 1 11 THR 11 11 11 THR THR B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 TYR 13 13 13 TYR TYR B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 HIS 15 15 15 HIS HIS B . n B 1 16 PRO 16 16 16 PRO PRO B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 ALA 19 19 19 ALA ALA B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 ASP 21 21 21 ASP ASP B . n B 1 22 PHE 22 22 22 PHE PHE B . n B 1 23 GLN 23 23 23 GLN GLN B . n B 1 24 THR 24 24 24 THR THR B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 GLU 26 26 26 GLU GLU B . n B 1 27 ALA 27 27 27 ALA ALA B . n B 1 28 ILE 28 28 28 ILE ILE B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 SER 30 30 30 SER SER B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 PRO 32 32 32 PRO PRO B . n B 1 33 ARG 33 33 33 ARG ARG B . n B 1 34 SER 34 34 34 SER SER B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 PHE 40 40 40 PHE PHE B . n B 1 41 ARG 41 41 41 ARG ARG B . n B 1 42 ASN 42 42 42 ASN ASN B . n B 1 43 ALA 43 43 43 ALA ALA B . n B 1 44 PHE 44 44 44 PHE PHE B . n B 1 45 ILE 45 45 45 ILE ILE B . n B 1 46 SER 46 46 46 SER SER B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 MET 48 48 48 MET MET B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 HIS 51 51 51 HIS HIS B . n B 1 52 GLN 52 52 52 GLN GLN B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 ASP 54 54 54 ASP ASP B . n B 1 55 PRO 55 55 55 PRO PRO B . n B 1 56 ARG 56 56 56 ARG ARG B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 PRO 58 58 58 PRO PRO B . n B 1 59 VAL 59 59 59 VAL VAL B . n B 1 60 LEU 60 60 60 LEU LEU B . n B 1 61 LEU 61 61 61 LEU LEU B . n B 1 62 THR 62 62 62 THR THR B . n B 1 63 ALA 63 63 63 ALA ALA B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 SER 66 66 66 SER SER B . n B 1 67 GLU 67 67 67 GLU GLU B . n B 1 68 GLU 68 68 68 GLU GLU B . n B 1 69 PHE 69 69 69 PHE PHE B . n B 1 70 SER 70 70 70 SER SER B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 ASP 72 72 72 ASP ASP B . n B 1 73 GLN 73 73 73 GLN GLN B . n B 1 74 VAL 74 74 74 VAL VAL B . n B 1 75 VAL 75 75 75 VAL VAL B . n B 1 76 THR 76 76 76 THR THR B . n B 1 77 LEU 77 77 77 LEU LEU B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 SER 79 79 79 SER SER B . n B 1 80 GLN 80 80 80 GLN GLN B . n B 1 81 THR 81 81 81 THR THR B . n B 1 82 THR 82 82 82 THR THR B . n B 1 83 GLY 83 83 83 GLY GLY B . n B 1 84 TRP 84 84 84 TRP TRP B . n B 1 85 LYS 85 85 85 LYS LYS B . n B 1 86 PRO 86 86 86 PRO PRO B . n B 1 87 SER 87 87 87 SER SER B . n B 1 88 GLN 88 88 88 GLN GLN B . n B 1 89 ALA 89 89 89 ALA ALA B . n B 1 90 ASP 90 90 90 ASP ASP B . n B 1 91 ILE 91 91 91 ILE ILE B . n B 1 92 ARG 92 92 92 ARG ARG B . n B 1 93 ALA 93 93 93 ALA ALA B . n B 1 94 VAL 94 94 94 VAL VAL B . n B 1 95 LEU 95 95 95 LEU LEU B . n B 1 96 THR 96 96 96 THR THR B . n B 1 97 GLU 97 97 ? ? ? B . n B 1 98 LEU 98 98 ? ? ? B . n B 1 99 GLY 99 99 ? ? ? B . n B 1 100 ALA 100 100 ? ? ? B . n B 1 101 SER 101 101 ? ? ? B . n B 1 102 GLN 102 102 ? ? ? B . n B 1 103 SER 103 103 ? ? ? B . n B 1 104 VAL 104 104 ? ? ? B . n B 1 105 GLU 105 105 ? ? ? B . n B 1 106 LYS 106 106 ? ? ? B . n B 1 107 MET 107 107 ? ? ? B . n B 1 108 PRO 108 108 ? ? ? B . n B 1 109 PRO 109 109 ? ? ? B . n B 1 110 SER 110 110 ? ? ? B . n B 1 111 ALA 111 111 ? ? ? B . n B 1 112 THR 112 112 ? ? ? B . n B 1 113 ASP 113 113 ? ? ? B . n B 1 114 SER 114 114 ? ? ? B . n B 1 115 VAL 115 115 ? ? ? B . n B 1 116 GLN 116 116 ? ? ? B . n B 1 117 GLU 117 117 ? ? ? B . n B 1 118 ALA 118 118 ? ? ? B . n B 1 119 MET 119 119 ? ? ? B . n B 1 120 ASN 120 120 ? ? ? B . n B 1 121 ASP 121 121 ? ? ? B . n B 1 122 VAL 122 122 ? ? ? B . n B 1 123 ARG 123 123 ? ? ? B . n B 1 124 LEU 124 124 ? ? ? B . n B 1 125 LYS 125 125 ? ? ? B . n B 1 126 MET 126 126 ? ? ? B . n B 1 127 LYS 127 127 ? ? ? B . n B 1 128 LYS 128 128 ? ? ? B . n B 1 129 LEU 129 129 ? ? ? B . n B 1 130 PHE 130 130 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 2001 2001 HOH HOH A . C 2 HOH 2 2002 2002 HOH HOH A . C 2 HOH 3 2003 2003 HOH HOH A . C 2 HOH 4 2004 2004 HOH HOH A . C 2 HOH 5 2005 2005 HOH HOH A . C 2 HOH 6 2006 2006 HOH HOH A . C 2 HOH 7 2007 2007 HOH HOH A . C 2 HOH 8 2008 2008 HOH HOH A . C 2 HOH 9 2009 2009 HOH HOH A . C 2 HOH 10 2010 2010 HOH HOH A . C 2 HOH 11 2011 2011 HOH HOH A . C 2 HOH 12 2012 2012 HOH HOH A . C 2 HOH 13 2013 2013 HOH HOH A . C 2 HOH 14 2014 2014 HOH HOH A . D 2 HOH 1 2001 2001 HOH HOH B . D 2 HOH 2 2002 2002 HOH HOH B . D 2 HOH 3 2003 2003 HOH HOH B . D 2 HOH 4 2004 2004 HOH HOH B . D 2 HOH 5 2005 2005 HOH HOH B . D 2 HOH 6 2006 2006 HOH HOH B . D 2 HOH 7 2007 2007 HOH HOH B . D 2 HOH 8 2008 2008 HOH HOH B . D 2 HOH 9 2009 2009 HOH HOH B . D 2 HOH 10 2010 2010 HOH HOH B . D 2 HOH 11 2011 2011 HOH HOH B . D 2 HOH 12 2012 2012 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6750 ? 1 MORE -63.3 ? 1 'SSA (A^2)' 12210 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 SOLVE phasing . ? 3 SHARP phasing . ? 4 CNS refinement 1.1 ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 7 ? ? 7.69 88.25 2 1 SER A 30 ? ? -80.11 32.29 3 1 ASP A 54 ? ? -177.90 124.83 4 1 LEU A 65 ? ? -38.65 120.25 5 1 SER A 87 ? ? -116.44 -128.99 6 1 ALA A 89 ? ? -64.97 5.96 7 1 LEU A 95 ? ? -111.37 -81.77 8 1 ARG B 7 ? ? 172.72 124.02 9 1 PRO B 16 ? ? -48.86 -5.63 10 1 ASP B 54 ? ? -175.52 117.66 11 1 ALA B 93 ? ? -70.61 47.72 12 1 VAL B 94 ? ? -98.42 51.06 13 1 LEU B 95 ? ? 73.56 31.54 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 96 ? CA ? A THR 96 CA 2 1 Y 1 A THR 96 ? C ? A THR 96 C 3 1 Y 1 A THR 96 ? O ? A THR 96 O 4 1 Y 1 A THR 96 ? CB ? A THR 96 CB 5 1 Y 1 A THR 96 ? OG1 ? A THR 96 OG1 6 1 Y 1 A THR 96 ? CG2 ? A THR 96 CG2 7 1 Y 1 B THR 96 ? CA ? B THR 96 CA 8 1 Y 1 B THR 96 ? C ? B THR 96 C 9 1 Y 1 B THR 96 ? O ? B THR 96 O 10 1 Y 1 B THR 96 ? CB ? B THR 96 CB 11 1 Y 1 B THR 96 ? OG1 ? B THR 96 OG1 12 1 Y 1 B THR 96 ? CG2 ? B THR 96 CG2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A GLU 97 ? A GLU 97 7 1 Y 1 A LEU 98 ? A LEU 98 8 1 Y 1 A GLY 99 ? A GLY 99 9 1 Y 1 A ALA 100 ? A ALA 100 10 1 Y 1 A SER 101 ? A SER 101 11 1 Y 1 A GLN 102 ? A GLN 102 12 1 Y 1 A SER 103 ? A SER 103 13 1 Y 1 A VAL 104 ? A VAL 104 14 1 Y 1 A GLU 105 ? A GLU 105 15 1 Y 1 A LYS 106 ? A LYS 106 16 1 Y 1 A MET 107 ? A MET 107 17 1 Y 1 A PRO 108 ? A PRO 108 18 1 Y 1 A PRO 109 ? A PRO 109 19 1 Y 1 A SER 110 ? A SER 110 20 1 Y 1 A ALA 111 ? A ALA 111 21 1 Y 1 A THR 112 ? A THR 112 22 1 Y 1 A ASP 113 ? A ASP 113 23 1 Y 1 A SER 114 ? A SER 114 24 1 Y 1 A VAL 115 ? A VAL 115 25 1 Y 1 A GLN 116 ? A GLN 116 26 1 Y 1 A GLU 117 ? A GLU 117 27 1 Y 1 A ALA 118 ? A ALA 118 28 1 Y 1 A MET 119 ? A MET 119 29 1 Y 1 A ASN 120 ? A ASN 120 30 1 Y 1 A ASP 121 ? A ASP 121 31 1 Y 1 A VAL 122 ? A VAL 122 32 1 Y 1 A ARG 123 ? A ARG 123 33 1 Y 1 A LEU 124 ? A LEU 124 34 1 Y 1 A LYS 125 ? A LYS 125 35 1 Y 1 A MET 126 ? A MET 126 36 1 Y 1 A LYS 127 ? A LYS 127 37 1 Y 1 A LYS 128 ? A LYS 128 38 1 Y 1 A LEU 129 ? A LEU 129 39 1 Y 1 A PHE 130 ? A PHE 130 40 1 Y 1 B MET 1 ? B MET 1 41 1 Y 1 B ASP 2 ? B ASP 2 42 1 Y 1 B ASP 3 ? B ASP 3 43 1 Y 1 B GLU 4 ? B GLU 4 44 1 Y 1 B ARG 5 ? B ARG 5 45 1 Y 1 B GLU 97 ? B GLU 97 46 1 Y 1 B LEU 98 ? B LEU 98 47 1 Y 1 B GLY 99 ? B GLY 99 48 1 Y 1 B ALA 100 ? B ALA 100 49 1 Y 1 B SER 101 ? B SER 101 50 1 Y 1 B GLN 102 ? B GLN 102 51 1 Y 1 B SER 103 ? B SER 103 52 1 Y 1 B VAL 104 ? B VAL 104 53 1 Y 1 B GLU 105 ? B GLU 105 54 1 Y 1 B LYS 106 ? B LYS 106 55 1 Y 1 B MET 107 ? B MET 107 56 1 Y 1 B PRO 108 ? B PRO 108 57 1 Y 1 B PRO 109 ? B PRO 109 58 1 Y 1 B SER 110 ? B SER 110 59 1 Y 1 B ALA 111 ? B ALA 111 60 1 Y 1 B THR 112 ? B THR 112 61 1 Y 1 B ASP 113 ? B ASP 113 62 1 Y 1 B SER 114 ? B SER 114 63 1 Y 1 B VAL 115 ? B VAL 115 64 1 Y 1 B GLN 116 ? B GLN 116 65 1 Y 1 B GLU 117 ? B GLU 117 66 1 Y 1 B ALA 118 ? B ALA 118 67 1 Y 1 B MET 119 ? B MET 119 68 1 Y 1 B ASN 120 ? B ASN 120 69 1 Y 1 B ASP 121 ? B ASP 121 70 1 Y 1 B VAL 122 ? B VAL 122 71 1 Y 1 B ARG 123 ? B ARG 123 72 1 Y 1 B LEU 124 ? B LEU 124 73 1 Y 1 B LYS 125 ? B LYS 125 74 1 Y 1 B MET 126 ? B MET 126 75 1 Y 1 B LYS 127 ? B LYS 127 76 1 Y 1 B LYS 128 ? B LYS 128 77 1 Y 1 B LEU 129 ? B LEU 129 78 1 Y 1 B PHE 130 ? B PHE 130 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #