data_2JDC # _entry.id 2JDC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2JDC PDBE EBI-31000 WWPDB D_1290031000 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2JDD _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'GLYPHOSATE N-ACETYLTRANSFERASE BOUND TO ACETYL COA AND 3-PHOSPHOGLYCERATE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2JDC _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2007-01-05 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Siehl, D.L.' 1 'Castle, L.A.' 2 'Gorton, R.' 3 'Keenan, R.J.' 4 # _citation.id primary _citation.title 'The Molecular Basis of Glyphosate Resistance by an Optimized Microbial Acetyltransferase.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 11446 _citation.page_last ? _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17272278 _citation.pdbx_database_id_DOI 10.1074/JBC.M610267200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Siehl, D.L.' 1 primary 'Castle, L.A.' 2 primary 'Gorton, R.' 3 primary 'Keenan, R.J.' 4 # _cell.entry_id 2JDC _cell.length_a 69.056 _cell.length_b 48.911 _cell.length_c 46.461 _cell.angle_alpha 90.00 _cell.angle_beta 103.54 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JDC _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GLYPHOSATE N-ACETYLTRANSFERASE' 16624.992 1 ? ? ? ? 2 non-polymer syn 'OXIDIZED COENZYME A' 783.534 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 131 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEG YREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT ; _entity_poly.pdbx_seq_one_letter_code_can ;MIEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEG YREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 GLU n 1 4 VAL n 1 5 LYS n 1 6 PRO n 1 7 ILE n 1 8 ASN n 1 9 ALA n 1 10 GLU n 1 11 ASP n 1 12 THR n 1 13 TYR n 1 14 GLU n 1 15 LEU n 1 16 ARG n 1 17 HIS n 1 18 ARG n 1 19 ILE n 1 20 LEU n 1 21 ARG n 1 22 PRO n 1 23 ASN n 1 24 GLN n 1 25 PRO n 1 26 ILE n 1 27 GLU n 1 28 ALA n 1 29 CYS n 1 30 MET n 1 31 PHE n 1 32 GLU n 1 33 SER n 1 34 ASP n 1 35 LEU n 1 36 LEU n 1 37 ARG n 1 38 GLY n 1 39 ALA n 1 40 PHE n 1 41 HIS n 1 42 LEU n 1 43 GLY n 1 44 GLY n 1 45 TYR n 1 46 TYR n 1 47 GLY n 1 48 GLY n 1 49 LYS n 1 50 LEU n 1 51 ILE n 1 52 SER n 1 53 ILE n 1 54 ALA n 1 55 SER n 1 56 PHE n 1 57 HIS n 1 58 GLN n 1 59 ALA n 1 60 GLU n 1 61 HIS n 1 62 SER n 1 63 GLU n 1 64 LEU n 1 65 GLN n 1 66 GLY n 1 67 GLN n 1 68 LYS n 1 69 GLN n 1 70 TYR n 1 71 GLN n 1 72 LEU n 1 73 ARG n 1 74 GLY n 1 75 MET n 1 76 ALA n 1 77 THR n 1 78 LEU n 1 79 GLU n 1 80 GLY n 1 81 TYR n 1 82 ARG n 1 83 GLU n 1 84 GLN n 1 85 LYS n 1 86 ALA n 1 87 GLY n 1 88 SER n 1 89 SER n 1 90 LEU n 1 91 ILE n 1 92 LYS n 1 93 HIS n 1 94 ALA n 1 95 GLU n 1 96 GLU n 1 97 ILE n 1 98 LEU n 1 99 ARG n 1 100 LYS n 1 101 ARG n 1 102 GLY n 1 103 ALA n 1 104 ASP n 1 105 LEU n 1 106 LEU n 1 107 TRP n 1 108 CYS n 1 109 ASN n 1 110 ALA n 1 111 ARG n 1 112 THR n 1 113 SER n 1 114 ALA n 1 115 SER n 1 116 GLY n 1 117 TYR n 1 118 TYR n 1 119 LYS n 1 120 LYS n 1 121 LEU n 1 122 GLY n 1 123 PHE n 1 124 SER n 1 125 GLU n 1 126 GLN n 1 127 GLY n 1 128 GLU n 1 129 VAL n 1 130 PHE n 1 131 ASP n 1 132 THR n 1 133 PRO n 1 134 PRO n 1 135 VAL n 1 136 GLY n 1 137 PRO n 1 138 HIS n 1 139 ILE n 1 140 LEU n 1 141 MET n 1 142 TYR n 1 143 LYS n 1 144 ARG n 1 145 ILE n 1 146 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BACILLUS LICHENIFORMIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1402 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain TG1 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PQE80 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'THE ENZYME IS A SHUFFLED VARIANT DERIVED FROM GENES DISCOVERED IN B. LICHENIFORMIS.' # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2JDC _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession 2JDC _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JDC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2JDC _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 146 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAO non-polymer . 'OXIDIZED COENZYME A' ? 'C21 H36 N7 O17 P3 S' 783.534 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2JDC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.3 _exptl_crystal.density_percent_sol 46 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.60 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '100 MM SODIUM ACETATE, PH 4.6 150-300 MM AMMONIUM SULFATE 20-25% PEG4000 2 MM ACETYL COA' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2003-06-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0072 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_wavelength 1.0072 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2JDC _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 32.200 _reflns.d_resolution_high 1.600 _reflns.number_obs 19217 _reflns.number_all ? _reflns.percent_possible_obs 96.0 _reflns.pdbx_Rmerge_I_obs 0.02000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 47.9000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.300 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.66 _reflns_shell.percent_possible_all 75.4 _reflns_shell.Rmerge_I_obs 0.06000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 19.000 _reflns_shell.pdbx_redundancy 2.80 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2JDC _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 18217 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 32.16 _refine.ls_d_res_high 1.60 _refine.ls_percent_reflns_obs 96.1 _refine.ls_R_factor_obs 0.149 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.148 _refine.ls_R_factor_R_free 0.172 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.190 _refine.ls_number_reflns_R_free 989 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.963 _refine.correlation_coeff_Fo_to_Fc_free 0.960 _refine.B_iso_mean 11.77 _refine.aniso_B[1][1] 0.03000 _refine.aniso_B[2][2] -0.01700 _refine.aniso_B[3][3] -0.00900 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00900 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. PARTIALLY DISORDERED SURFACE SIDECHAINS WERE MODELED STEREOCHEMICALLY. DISORDERED OR RADIATION DAMAGED SURFACE SIDECHAIN ATOMS WERE MODELED AT 0.5 OCCUPANCY ; _refine.pdbx_starting_model 'PDB ENTRY 2BSW' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.115 _refine.pdbx_overall_ESU_R_Free 0.077 _refine.overall_SU_ML 0.042 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.568 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1161 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 54 _refine_hist.number_atoms_solvent 131 _refine_hist.number_atoms_total 1346 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 32.16 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.011 0.021 ? 1246 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.449 2.016 ? 1685 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.192 5.000 ? 146 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 29.765 23.103 ? 58 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 11.386 15.000 ? 214 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.971 15.000 ? 10 'X-RAY DIFFRACTION' ? r_chiral_restr 0.083 0.200 ? 171 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 1359 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.202 0.200 ? 210 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.176 0.200 ? 580 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.120 0.200 ? 87 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.090 0.200 ? 5 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.146 0.200 ? 14 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.408 1.500 ? 936 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.592 2.000 ? 1148 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.491 3.000 ? 619 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.193 4.500 ? 536 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.60 _refine_ls_shell.d_res_low 1.64 _refine_ls_shell.number_reflns_R_work 999 _refine_ls_shell.R_factor_R_work 0.1160 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.1940 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 62 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2JDC _struct.title 'Glyphosate N-acetyltransferase bound to oxidized COA and sulfate' _struct.pdbx_descriptor 'GLYPHOSATE N-ACETYLTRANSFERASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JDC _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'GNAT, GLYPHOSATE, TRANSFERASE, N-ACETYLTRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 8 ? ASP A 11 ? ASN A 8 ASP A 11 5 ? 4 HELX_P HELX_P2 2 THR A 12 ? LEU A 20 ? THR A 12 LEU A 20 1 ? 9 HELX_P HELX_P3 3 PRO A 25 ? MET A 30 ? PRO A 25 MET A 30 5 ? 6 HELX_P HELX_P4 4 PHE A 31 ? LEU A 36 ? PHE A 31 LEU A 36 5 ? 6 HELX_P HELX_P5 5 LYS A 85 ? ARG A 101 ? LYS A 85 ARG A 101 1 ? 17 HELX_P HELX_P6 6 ALA A 114 ? LEU A 121 ? ALA A 114 LEU A 121 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 133 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 133 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 134 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 134 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.68 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLU A 3 ? ILE A 7 ? GLU A 3 ILE A 7 AA 2 PHE A 40 ? TYR A 46 ? PHE A 40 TYR A 46 AA 3 LYS A 49 ? GLN A 58 ? LYS A 49 GLN A 58 AA 4 GLN A 69 ? THR A 77 ? GLN A 69 THR A 77 AA 5 LEU A 105 ? ARG A 111 ? LEU A 105 ARG A 111 AA 6 PRO A 137 ? ARG A 144 ? PRO A 137 ARG A 144 AA 7 SER A 124 ? ASP A 131 ? SER A 124 ASP A 131 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 7 ? N ILE A 7 O HIS A 41 ? O HIS A 41 AA 2 3 N TYR A 46 ? N TYR A 46 O LYS A 49 ? O LYS A 49 AA 3 4 N HIS A 57 ? N HIS A 57 O GLN A 71 ? O GLN A 71 AA 4 5 N TYR A 70 ? N TYR A 70 O LEU A 105 ? O LEU A 105 AA 5 6 N ALA A 110 ? N ALA A 110 O ILE A 139 ? O ILE A 139 AA 6 7 N TYR A 142 ? N TYR A 142 O SER A 124 ? O SER A 124 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 1148' AC2 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE CAO A 1147' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ARG A 21 ? ARG A 21 . ? 1_555 ? 2 AC1 7 ARG A 73 ? ARG A 73 . ? 1_555 ? 3 AC1 7 ARG A 111 ? ARG A 111 . ? 1_555 ? 4 AC1 7 HIS A 138 ? HIS A 138 . ? 1_555 ? 5 AC1 7 CAO B . ? CAO A 1147 . ? 1_555 ? 6 AC1 7 HOH D . ? HOH A 2130 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 2131 . ? 1_555 ? 8 AC2 29 ILE A 19 ? ILE A 19 . ? 1_555 ? 9 AC2 29 MET A 75 ? MET A 75 . ? 1_555 ? 10 AC2 29 ALA A 76 ? ALA A 76 . ? 1_555 ? 11 AC2 29 THR A 77 ? THR A 77 . ? 1_555 ? 12 AC2 29 ARG A 82 ? ARG A 82 . ? 1_555 ? 13 AC2 29 GLU A 83 ? GLU A 83 . ? 1_555 ? 14 AC2 29 GLN A 84 ? GLN A 84 . ? 1_555 ? 15 AC2 29 LYS A 85 ? LYS A 85 . ? 1_555 ? 16 AC2 29 GLY A 87 ? GLY A 87 . ? 1_555 ? 17 AC2 29 SER A 88 ? SER A 88 . ? 1_555 ? 18 AC2 29 ASN A 109 ? ASN A 109 . ? 1_555 ? 19 AC2 29 ARG A 111 ? ARG A 111 . ? 1_555 ? 20 AC2 29 SER A 113 ? SER A 113 . ? 1_555 ? 21 AC2 29 ALA A 114 ? ALA A 114 . ? 1_555 ? 22 AC2 29 GLY A 116 ? GLY A 116 . ? 1_555 ? 23 AC2 29 TYR A 117 ? TYR A 117 . ? 1_555 ? 24 AC2 29 TYR A 118 ? TYR A 118 . ? 1_555 ? 25 AC2 29 LYS A 120 ? LYS A 120 . ? 1_555 ? 26 AC2 29 SO4 C . ? SO4 A 1148 . ? 1_555 ? 27 AC2 29 HOH D . ? HOH A 2082 . ? 1_555 ? 28 AC2 29 HOH D . ? HOH A 2099 . ? 1_555 ? 29 AC2 29 HOH D . ? HOH A 2101 . ? 1_555 ? 30 AC2 29 HOH D . ? HOH A 2123 . ? 1_555 ? 31 AC2 29 HOH D . ? HOH A 2124 . ? 1_555 ? 32 AC2 29 HOH D . ? HOH A 2125 . ? 1_555 ? 33 AC2 29 HOH D . ? HOH A 2126 . ? 1_555 ? 34 AC2 29 HOH D . ? HOH A 2127 . ? 1_555 ? 35 AC2 29 HOH D . ? HOH A 2128 . ? 1_555 ? 36 AC2 29 HOH D . ? HOH A 2129 . ? 1_555 ? # _database_PDB_matrix.entry_id 2JDC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2JDC _atom_sites.fract_transf_matrix[1][1] 0.014481 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003487 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020445 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022139 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 TRP 107 107 107 TRP TRP A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 MET 141 141 141 MET MET A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 THR 146 146 146 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CAO 1 1147 1147 CAO CAO A . C 3 SO4 1 1148 1148 SO4 SO4 A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . D 4 HOH 110 2110 2110 HOH HOH A . D 4 HOH 111 2111 2111 HOH HOH A . D 4 HOH 112 2112 2112 HOH HOH A . D 4 HOH 113 2113 2113 HOH HOH A . D 4 HOH 114 2114 2114 HOH HOH A . D 4 HOH 115 2115 2115 HOH HOH A . D 4 HOH 116 2116 2116 HOH HOH A . D 4 HOH 117 2117 2117 HOH HOH A . D 4 HOH 118 2118 2118 HOH HOH A . D 4 HOH 119 2119 2119 HOH HOH A . D 4 HOH 120 2120 2120 HOH HOH A . D 4 HOH 121 2121 2121 HOH HOH A . D 4 HOH 122 2122 2122 HOH HOH A . D 4 HOH 123 2123 2123 HOH HOH A . D 4 HOH 124 2124 2124 HOH HOH A . D 4 HOH 125 2125 2125 HOH HOH A . D 4 HOH 126 2126 2126 HOH HOH A . D 4 HOH 127 2127 2127 HOH HOH A . D 4 HOH 128 2128 2128 HOH HOH A . D 4 HOH 129 2129 2129 HOH HOH A . D 4 HOH 130 2130 2130 HOH HOH A . D 4 HOH 131 2131 2131 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2017 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-02-13 2 'Structure model' 1 1 2013-04-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other 5 2 'Structure model' 'Source and taxonomy' 6 2 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 # _pdbx_entry_details.entry_id 2JDC _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE N-TERMINAL METHIONINE RESIDUE IS DISORDERED IN THE ELECTRON DENSITY, AND WAS NOT MODELED. SEQUENCE DATABASE: GENBANK DATABASE ACCESSION NUMBER: AY597417 ; # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'OXIDIZED COENZYME A' CAO 3 'SULFATE ION' SO4 4 water HOH #