data_2JK7 # _entry.id 2JK7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2JK7 PDBE EBI-37235 WWPDB D_1290037235 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1KMC unspecified 'CRYSTAL STRUCTURE OF THE CASPASE-7 / XIAP- BIR2 COMPLEX' PDB 1F9X unspecified 'AVERAGE NMR SOLUTION STRUCTURE OF THE BIR- 3 DOMAIN OF XIAP' PDB 1G73 unspecified 'CRYSTAL STRUCTURE OF SMAC BOUND TO XIAP- BIR3 DOMAIN' PDB 1I4O unspecified 'CRYSTAL STRUCTURE OF THE XIAP/CASPASE-7 COMPLEX' PDB 2VSL unspecified 'CRYSTAL STRUCTURE OF XIAP BIR3 WITH A BIVALENT SMAC MIMETIC' PDB 1TFQ unspecified 'NMR STRUCTURE OF AN ANTAGONISTS OF THE XIAP-CASPASE-9INTERACTION COMPLEXED TO THE BIR3 DOMAIN OF XIAP' PDB 1TFT unspecified 'NMR STRUCTURE OF AN ANTAGONISTS OF THE XIAP-CASPASE-9INTERACTION COMPLEXED TO THE BIR3 DOMAIN OF XIAP' PDB 1C9Q unspecified 'AVERAGE NMR SOLUTION STRUCTURE OF THE BIR- 2 DOMAIN OF XIAP' PDB 1NW9 unspecified 'STRUCTURE OF CASPASE-9 IN AN INHIBITORY COMPLEX WITH XIAP-BIR3' PDB 1I3O unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF XIAP- BIR2 AND CASPASE 3' PDB 1I51 unspecified 'CRYSTAL STRUCTURE OF CASPASE-7 COMPLEXED WITH XIAP' PDB 1G3F unspecified 'NMR STRUCTURE OF A 9 RESIDUE PEPTIDE FROM SMAC/DIABLOCOMPLEXED TO THE BIR3 DOMAIN OF XIAP' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2JK7 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2008-08-21 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Saito, N.G.' 1 'Meagher, J.L.' 2 'Stuckey, J.A.' 3 # _citation.id primary _citation.title ;Structure-Based Design, Synthesis, Evaluation, and Crystallographic Studies of Conformationally Constrained Smac Mimetics as Inhibitors of the X-Linked Inhibitor of Apoptosis Protein (Xiap). ; _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 51 _citation.page_first 7169 _citation.page_last ? _citation.year 2008 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18954041 _citation.pdbx_database_id_DOI 10.1021/JM8006849 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Sun, H.' 1 primary 'Stuckey, J.A.' 2 primary 'Nikolovska-Coleska, Z.' 3 primary 'Qin, D.' 4 primary 'Meagher, J.L.' 5 primary 'Qiu, S.' 6 primary 'Lu, J.' 7 primary 'Yang, C.' 8 primary 'Saito, N.G.' 9 primary 'Wang, S.' 10 # _cell.entry_id 2JK7 _cell.length_a 115.760 _cell.length_b 115.760 _cell.length_c 61.790 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JK7 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'BACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 4' 13293.755 1 ? ? 'BIR3, RESIDUES 241-356' 'SMALL MOLECULE SMAC MIMETIC' 2 non-polymer syn ;(3S,6S,7Z,10AS)-N-(DIPHENYLMETHYL)-6-{[(2S)-2-(METHYLIDENEAMINO)BUTANOYL]AMINO}-5-OXO-1,2,3,5,6,9,10,10A-OCTAHYDROPYRROLO[1,2-A]AZOCINE-3-CARBOXAMIDE ; 486.605 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 37 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'E3 UBIQUITIN-PROTEIN LIGASE XIAP, INHIBITOR OF APOPTOSIS PROTEIN 3, X-LINKED INHIBITOR OF APOPTOSIS PROTEIN, IAP-LIKE PROTEIN, HILP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQH AKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT ; _entity_poly.pdbx_seq_one_letter_code_can ;SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQH AKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 ALA n 1 4 VAL n 1 5 SER n 1 6 SER n 1 7 ASP n 1 8 ARG n 1 9 ASN n 1 10 PHE n 1 11 PRO n 1 12 ASN n 1 13 SER n 1 14 THR n 1 15 ASN n 1 16 LEU n 1 17 PRO n 1 18 ARG n 1 19 ASN n 1 20 PRO n 1 21 SER n 1 22 MET n 1 23 ALA n 1 24 ASP n 1 25 TYR n 1 26 GLU n 1 27 ALA n 1 28 ARG n 1 29 ILE n 1 30 PHE n 1 31 THR n 1 32 PHE n 1 33 GLY n 1 34 THR n 1 35 TRP n 1 36 ILE n 1 37 TYR n 1 38 SER n 1 39 VAL n 1 40 ASN n 1 41 LYS n 1 42 GLU n 1 43 GLN n 1 44 LEU n 1 45 ALA n 1 46 ARG n 1 47 ALA n 1 48 GLY n 1 49 PHE n 1 50 TYR n 1 51 ALA n 1 52 LEU n 1 53 GLY n 1 54 GLU n 1 55 GLY n 1 56 ASP n 1 57 LYS n 1 58 VAL n 1 59 LYS n 1 60 CYS n 1 61 PHE n 1 62 HIS n 1 63 CYS n 1 64 GLY n 1 65 GLY n 1 66 GLY n 1 67 LEU n 1 68 THR n 1 69 ASP n 1 70 TRP n 1 71 LYS n 1 72 PRO n 1 73 SER n 1 74 GLU n 1 75 ASP n 1 76 PRO n 1 77 TRP n 1 78 GLU n 1 79 GLN n 1 80 HIS n 1 81 ALA n 1 82 LYS n 1 83 TRP n 1 84 TYR n 1 85 PRO n 1 86 GLY n 1 87 CYS n 1 88 LYS n 1 89 TYR n 1 90 LEU n 1 91 LEU n 1 92 GLU n 1 93 GLN n 1 94 LYS n 1 95 GLY n 1 96 GLN n 1 97 GLU n 1 98 TYR n 1 99 ILE n 1 100 ASN n 1 101 ASN n 1 102 ILE n 1 103 HIS n 1 104 LEU n 1 105 THR n 1 106 HIS n 1 107 SER n 1 108 LEU n 1 109 GLU n 1 110 GLU n 1 111 CYS n 1 112 LEU n 1 113 VAL n 1 114 ARG n 1 115 THR n 1 116 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BIRC4_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P98170 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JK7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P98170 _struct_ref_seq.db_align_beg 241 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 356 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 241 _struct_ref_seq.pdbx_auth_seq_align_end 356 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BI6 non-polymer . ;(3S,6S,7Z,10AS)-N-(DIPHENYLMETHYL)-6-{[(2S)-2-(METHYLIDENEAMINO)BUTANOYL]AMINO}-5-OXO-1,2,3,5,6,9,10,10A-OCTAHYDROPYRROLO[1,2-A]AZOCINE-3-CARBOXAMIDE ; ? 'C29 H34 N4 O3' 486.605 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2JK7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.6 _exptl_crystal.density_percent_sol 66 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '20% POLYETHYLENE GLYCOL 8000 0.2M MGCL2 0.1M TRIS, PH 8.5' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2004-07-14 _diffrn_detector.details DIAMOND # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 32-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 32-ID _diffrn_source.pdbx_wavelength 1.00 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2JK7 _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 2.80 _reflns.number_obs 6181 _reflns.number_all ? _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 20.00 _reflns.B_iso_Wilson_estimate 61.9 _reflns.pdbx_redundancy 9 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.80 _reflns_shell.d_res_low 2.90 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.30 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.00 _reflns_shell.pdbx_redundancy 9 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2JK7 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 5155 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 414409.45 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.00 _refine.ls_d_res_high 2.82 _refine.ls_percent_reflns_obs 93.2 _refine.ls_R_factor_obs 0.229 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.229 _refine.ls_R_factor_R_free 0.276 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 11.0 _refine.ls_number_reflns_R_free 566 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 60.3 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.467133 _refine.solvent_model_param_bsol 73.6531 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'UNPUBLISHED STRUCTURE IN LAB' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 2JK7 _refine_analyze.Luzzati_coordinate_error_obs 0.40 _refine_analyze.Luzzati_sigma_a_obs 0.51 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.52 _refine_analyze.Luzzati_sigma_a_free 0.60 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 784 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 858 _refine_hist.d_res_high 2.82 _refine_hist.d_res_low 6.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 21.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.84 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.46 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.56 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 1.82 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.01 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.96 _refine_ls_shell.number_reflns_R_work 600 _refine_ls_shell.R_factor_R_work 0.380 _refine_ls_shell.percent_reflns_obs 71.8 _refine_ls_shell.R_factor_R_free 0.455 _refine_ls_shell.R_factor_R_free_error 0.058 _refine_ls_shell.percent_reflns_R_free 9.4 _refine_ls_shell.number_reflns_R_free 62 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' 4 SH130.PARAM SH130.TOP # _struct.entry_id 2JK7 _struct.title 'XIAP BIR3 bound to a Smac Mimetic' _struct.pdbx_descriptor 'BACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JK7 _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text ;ZINC-FINGER, POLYMORPHISM, SMAC MIMETIC, METAL-BINDING, BIR3, ZINC, LIGASE, APOPTOSIS, CYTOPLASM, X-LINKED INHIBITOR OF APOPTOSIS, UBL CONJUGATION PATHWAY, THIOL PROTEASE INHIBITOR, PHOSPHOPROTEIN, UBL CONJUGATION, PROTEASE INHIBITOR ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 19 ? ALA A 23 ? ASN A 259 ALA A 263 5 ? 5 HELX_P HELX_P2 2 ASP A 24 ? PHE A 32 ? ASP A 264 PHE A 272 1 ? 9 HELX_P HELX_P3 3 ASN A 40 ? ALA A 47 ? ASN A 280 ALA A 287 1 ? 8 HELX_P HELX_P4 4 ASP A 75 ? TYR A 84 ? ASP A 315 TYR A 324 1 ? 10 HELX_P HELX_P5 5 CYS A 87 ? THR A 105 ? CYS A 327 THR A 345 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 60 SG ? ? A ZN 1347 A CYS 300 1_555 ? ? ? ? ? ? ? 2.097 ? metalc2 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 63 SG ? ? A ZN 1347 A CYS 303 1_555 ? ? ? ? ? ? ? 2.279 ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 80 NE2 ? ? A ZN 1347 A HIS 320 1_555 ? ? ? ? ? ? ? 2.176 ? metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 87 SG ? ? A ZN 1347 A CYS 327 1_555 ? ? ? ? ? ? ? 2.361 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 PHE A 49 ? ALA A 51 ? PHE A 289 ALA A 291 AA 2 VAL A 58 ? CYS A 60 ? VAL A 298 CYS A 300 AA 3 GLY A 66 ? LEU A 67 ? GLY A 306 LEU A 307 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N TYR A 50 ? N TYR A 290 O LYS A 59 ? O LYS A 299 AA 2 3 N VAL A 58 ? N VAL A 298 O LEU A 67 ? O LEU A 307 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE BI6 A1346' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A1347' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 LYS A 57 ? LYS A 297 . ? 1_555 ? 2 AC1 12 VAL A 58 ? VAL A 298 . ? 1_555 ? 3 AC1 12 GLY A 66 ? GLY A 306 . ? 1_555 ? 4 AC1 12 LEU A 67 ? LEU A 307 . ? 1_555 ? 5 AC1 12 THR A 68 ? THR A 308 . ? 1_555 ? 6 AC1 12 ASP A 69 ? ASP A 309 . ? 1_555 ? 7 AC1 12 TRP A 70 ? TRP A 310 . ? 1_555 ? 8 AC1 12 LYS A 71 ? LYS A 311 . ? 1_555 ? 9 AC1 12 GLU A 74 ? GLU A 314 . ? 1_555 ? 10 AC1 12 TRP A 83 ? TRP A 323 . ? 1_555 ? 11 AC1 12 TYR A 84 ? TYR A 324 . ? 1_555 ? 12 AC1 12 HOH D . ? HOH A 2037 . ? 1_555 ? 13 AC2 4 CYS A 60 ? CYS A 300 . ? 1_555 ? 14 AC2 4 CYS A 63 ? CYS A 303 . ? 1_555 ? 15 AC2 4 HIS A 80 ? HIS A 320 . ? 1_555 ? 16 AC2 4 CYS A 87 ? CYS A 327 . ? 1_555 ? # _database_PDB_matrix.entry_id 2JK7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2JK7 _atom_sites.fract_transf_matrix[1][1] 0.008639 _atom_sites.fract_transf_matrix[1][2] 0.004987 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009975 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016184 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 241 ? ? ? A . n A 1 2 ASP 2 242 ? ? ? A . n A 1 3 ALA 3 243 ? ? ? A . n A 1 4 VAL 4 244 ? ? ? A . n A 1 5 SER 5 245 ? ? ? A . n A 1 6 SER 6 246 ? ? ? A . n A 1 7 ASP 7 247 ? ? ? A . n A 1 8 ARG 8 248 ? ? ? A . n A 1 9 ASN 9 249 ? ? ? A . n A 1 10 PHE 10 250 250 PHE PHE A . n A 1 11 PRO 11 251 251 PRO PRO A . n A 1 12 ASN 12 252 252 ASN ASN A . n A 1 13 SER 13 253 253 SER SER A . n A 1 14 THR 14 254 254 THR THR A . n A 1 15 ASN 15 255 255 ASN ASN A . n A 1 16 LEU 16 256 256 LEU LEU A . n A 1 17 PRO 17 257 257 PRO PRO A . n A 1 18 ARG 18 258 258 ARG ARG A . n A 1 19 ASN 19 259 259 ASN ASN A . n A 1 20 PRO 20 260 260 PRO PRO A . n A 1 21 SER 21 261 261 SER SER A . n A 1 22 MET 22 262 262 MET MET A . n A 1 23 ALA 23 263 263 ALA ALA A . n A 1 24 ASP 24 264 264 ASP ASP A . n A 1 25 TYR 25 265 265 TYR TYR A . n A 1 26 GLU 26 266 266 GLU GLU A . n A 1 27 ALA 27 267 267 ALA ALA A . n A 1 28 ARG 28 268 268 ARG ARG A . n A 1 29 ILE 29 269 269 ILE ILE A . n A 1 30 PHE 30 270 270 PHE PHE A . n A 1 31 THR 31 271 271 THR THR A . n A 1 32 PHE 32 272 272 PHE PHE A . n A 1 33 GLY 33 273 273 GLY GLY A . n A 1 34 THR 34 274 274 THR THR A . n A 1 35 TRP 35 275 275 TRP TRP A . n A 1 36 ILE 36 276 276 ILE ILE A . n A 1 37 TYR 37 277 277 TYR TYR A . n A 1 38 SER 38 278 278 SER SER A . n A 1 39 VAL 39 279 279 VAL VAL A . n A 1 40 ASN 40 280 280 ASN ASN A . n A 1 41 LYS 41 281 281 LYS LYS A . n A 1 42 GLU 42 282 282 GLU GLU A . n A 1 43 GLN 43 283 283 GLN GLN A . n A 1 44 LEU 44 284 284 LEU LEU A . n A 1 45 ALA 45 285 285 ALA ALA A . n A 1 46 ARG 46 286 286 ARG ARG A . n A 1 47 ALA 47 287 287 ALA ALA A . n A 1 48 GLY 48 288 288 GLY GLY A . n A 1 49 PHE 49 289 289 PHE PHE A . n A 1 50 TYR 50 290 290 TYR TYR A . n A 1 51 ALA 51 291 291 ALA ALA A . n A 1 52 LEU 52 292 292 LEU LEU A . n A 1 53 GLY 53 293 293 GLY GLY A . n A 1 54 GLU 54 294 294 GLU GLU A . n A 1 55 GLY 55 295 295 GLY GLY A . n A 1 56 ASP 56 296 296 ASP ASP A . n A 1 57 LYS 57 297 297 LYS LYS A . n A 1 58 VAL 58 298 298 VAL VAL A . n A 1 59 LYS 59 299 299 LYS LYS A . n A 1 60 CYS 60 300 300 CYS CYS A . n A 1 61 PHE 61 301 301 PHE PHE A . n A 1 62 HIS 62 302 302 HIS HIS A . n A 1 63 CYS 63 303 303 CYS CYS A . n A 1 64 GLY 64 304 304 GLY GLY A . n A 1 65 GLY 65 305 305 GLY GLY A . n A 1 66 GLY 66 306 306 GLY GLY A . n A 1 67 LEU 67 307 307 LEU LEU A . n A 1 68 THR 68 308 308 THR THR A . n A 1 69 ASP 69 309 309 ASP ASP A . n A 1 70 TRP 70 310 310 TRP TRP A . n A 1 71 LYS 71 311 311 LYS LYS A . n A 1 72 PRO 72 312 312 PRO PRO A . n A 1 73 SER 73 313 313 SER SER A . n A 1 74 GLU 74 314 314 GLU GLU A . n A 1 75 ASP 75 315 315 ASP ASP A . n A 1 76 PRO 76 316 316 PRO PRO A . n A 1 77 TRP 77 317 317 TRP TRP A . n A 1 78 GLU 78 318 318 GLU GLU A . n A 1 79 GLN 79 319 319 GLN GLN A . n A 1 80 HIS 80 320 320 HIS HIS A . n A 1 81 ALA 81 321 321 ALA ALA A . n A 1 82 LYS 82 322 322 LYS LYS A . n A 1 83 TRP 83 323 323 TRP TRP A . n A 1 84 TYR 84 324 324 TYR TYR A . n A 1 85 PRO 85 325 325 PRO PRO A . n A 1 86 GLY 86 326 326 GLY GLY A . n A 1 87 CYS 87 327 327 CYS CYS A . n A 1 88 LYS 88 328 328 LYS LYS A . n A 1 89 TYR 89 329 329 TYR TYR A . n A 1 90 LEU 90 330 330 LEU LEU A . n A 1 91 LEU 91 331 331 LEU LEU A . n A 1 92 GLU 92 332 332 GLU GLU A . n A 1 93 GLN 93 333 333 GLN GLN A . n A 1 94 LYS 94 334 334 LYS LYS A . n A 1 95 GLY 95 335 335 GLY GLY A . n A 1 96 GLN 96 336 336 GLN GLN A . n A 1 97 GLU 97 337 337 GLU GLU A . n A 1 98 TYR 98 338 338 TYR TYR A . n A 1 99 ILE 99 339 339 ILE ILE A . n A 1 100 ASN 100 340 340 ASN ASN A . n A 1 101 ASN 101 341 341 ASN ASN A . n A 1 102 ILE 102 342 342 ILE ILE A . n A 1 103 HIS 103 343 343 HIS HIS A . n A 1 104 LEU 104 344 344 LEU LEU A . n A 1 105 THR 105 345 345 THR THR A . n A 1 106 HIS 106 346 346 HIS HIS A . n A 1 107 SER 107 347 ? ? ? A . n A 1 108 LEU 108 348 ? ? ? A . n A 1 109 GLU 109 349 ? ? ? A . n A 1 110 GLU 110 350 ? ? ? A . n A 1 111 CYS 111 351 ? ? ? A . n A 1 112 LEU 112 352 ? ? ? A . n A 1 113 VAL 113 353 ? ? ? A . n A 1 114 ARG 114 354 ? ? ? A . n A 1 115 THR 115 355 ? ? ? A . n A 1 116 THR 116 356 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BI6 1 1346 1346 BI6 BI6 A . C 3 ZN 1 1347 1347 ZN ZN A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 60 ? A CYS 300 ? 1_555 ZN ? C ZN . ? A ZN 1347 ? 1_555 SG ? A CYS 63 ? A CYS 303 ? 1_555 112.9 ? 2 SG ? A CYS 60 ? A CYS 300 ? 1_555 ZN ? C ZN . ? A ZN 1347 ? 1_555 NE2 ? A HIS 80 ? A HIS 320 ? 1_555 109.2 ? 3 SG ? A CYS 63 ? A CYS 303 ? 1_555 ZN ? C ZN . ? A ZN 1347 ? 1_555 NE2 ? A HIS 80 ? A HIS 320 ? 1_555 110.2 ? 4 SG ? A CYS 60 ? A CYS 300 ? 1_555 ZN ? C ZN . ? A ZN 1347 ? 1_555 SG ? A CYS 87 ? A CYS 327 ? 1_555 125.7 ? 5 SG ? A CYS 63 ? A CYS 303 ? 1_555 ZN ? C ZN . ? A ZN 1347 ? 1_555 SG ? A CYS 87 ? A CYS 327 ? 1_555 100.6 ? 6 NE2 ? A HIS 80 ? A HIS 320 ? 1_555 ZN ? C ZN . ? A ZN 1347 ? 1_555 SG ? A CYS 87 ? A CYS 327 ? 1_555 96.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-11-04 2 'Structure model' 1 1 2011-05-07 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 275 ? ? -31.55 115.72 2 1 HIS A 302 ? ? -92.10 -68.57 3 1 THR A 345 ? ? -124.23 -168.63 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2005 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.86 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 346 ? CA ? A HIS 106 CA 2 1 Y 1 A HIS 346 ? C ? A HIS 106 C 3 1 Y 1 A HIS 346 ? O ? A HIS 106 O 4 1 Y 1 A HIS 346 ? CB ? A HIS 106 CB 5 1 Y 1 A HIS 346 ? CG ? A HIS 106 CG 6 1 Y 1 A HIS 346 ? ND1 ? A HIS 106 ND1 7 1 Y 1 A HIS 346 ? CD2 ? A HIS 106 CD2 8 1 Y 1 A HIS 346 ? CE1 ? A HIS 106 CE1 9 1 Y 1 A HIS 346 ? NE2 ? A HIS 106 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 241 ? A SER 1 2 1 Y 1 A ASP 242 ? A ASP 2 3 1 Y 1 A ALA 243 ? A ALA 3 4 1 Y 1 A VAL 244 ? A VAL 4 5 1 Y 1 A SER 245 ? A SER 5 6 1 Y 1 A SER 246 ? A SER 6 7 1 Y 1 A ASP 247 ? A ASP 7 8 1 Y 1 A ARG 248 ? A ARG 8 9 1 Y 1 A ASN 249 ? A ASN 9 10 1 Y 1 A SER 347 ? A SER 107 11 1 Y 1 A LEU 348 ? A LEU 108 12 1 Y 1 A GLU 349 ? A GLU 109 13 1 Y 1 A GLU 350 ? A GLU 110 14 1 Y 1 A CYS 351 ? A CYS 111 15 1 Y 1 A LEU 352 ? A LEU 112 16 1 Y 1 A VAL 353 ? A VAL 113 17 1 Y 1 A ARG 354 ? A ARG 114 18 1 Y 1 A THR 355 ? A THR 115 19 1 Y 1 A THR 356 ? A THR 116 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(3S,6S,7Z,10AS)-N-(DIPHENYLMETHYL)-6-{[(2S)-2-(METHYLIDENEAMINO)BUTANOYL]AMINO}-5-OXO-1,2,3,5,6,9,10,10A-OCTAHYDROPYRROLO[1,2-A]AZOCINE-3-CARBOXAMIDE ; BI6 3 'ZINC ION' ZN 4 water HOH #