data_2JKG # _entry.id 2JKG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2JKG PDBE EBI-37322 WWPDB D_1290037322 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2JKF _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'PLASMODIUM FALCIPARUM PROFILIN' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2JKG _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2008-08-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kursula, I.' 1 'Kursula, P.' 2 'Ganter, M.' 3 'Panjikar, S.' 4 'Matuschewski, K.' 5 'Schueler, H.' 6 # _citation.id primary _citation.title 'Structural Basis for Parasite-Specific Functions of the Divergent Profilin of Plasmodium Falciparum.' _citation.journal_abbrev Structure _citation.journal_volume 16 _citation.page_first 1638 _citation.page_last ? _citation.year 2008 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19000816 _citation.pdbx_database_id_DOI 10.1016/J.STR.2008.09.008 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kursula, I.' 1 ? primary 'Kursula, P.' 2 ? primary 'Ganter, M.' 3 ? primary 'Panjikar, S.' 4 ? primary 'Matuschewski, K.' 5 ? primary 'Schuler, H.' 6 ? # _cell.entry_id 2JKG _cell.length_a 45.520 _cell.length_b 49.700 _cell.length_c 83.810 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JKG _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man PROFILIN 20102.010 1 ? ? ? ? 2 polymer syn 'OCTAPROLINE PEPTIDE' 794.934 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 100 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CONSERVED PROTEIN' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAEEYSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQT ILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAAL TFAKELAESSQLQHHHHHH ; ;MAEEYSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQT ILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAAL TFAKELAESSQLQHHHHHH ; A ? 2 'polypeptide(L)' no no PPPPPPPP PPPPPPPP P ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 GLU n 1 5 TYR n 1 6 SER n 1 7 TRP n 1 8 ASP n 1 9 SER n 1 10 TYR n 1 11 LEU n 1 12 ASN n 1 13 ASP n 1 14 ARG n 1 15 LEU n 1 16 LEU n 1 17 ALA n 1 18 THR n 1 19 ASN n 1 20 GLN n 1 21 VAL n 1 22 SER n 1 23 GLY n 1 24 ALA n 1 25 GLY n 1 26 LEU n 1 27 ALA n 1 28 SER n 1 29 GLU n 1 30 GLU n 1 31 ASP n 1 32 GLY n 1 33 VAL n 1 34 VAL n 1 35 TYR n 1 36 ALA n 1 37 CYS n 1 38 VAL n 1 39 ALA n 1 40 GLN n 1 41 GLY n 1 42 GLU n 1 43 GLU n 1 44 SER n 1 45 ASP n 1 46 PRO n 1 47 ASN n 1 48 PHE n 1 49 ASP n 1 50 LYS n 1 51 TRP n 1 52 SER n 1 53 LEU n 1 54 PHE n 1 55 TYR n 1 56 LYS n 1 57 GLU n 1 58 ASP n 1 59 TYR n 1 60 ASP n 1 61 ILE n 1 62 GLU n 1 63 VAL n 1 64 GLU n 1 65 ASP n 1 66 GLU n 1 67 ASN n 1 68 GLY n 1 69 THR n 1 70 LYS n 1 71 THR n 1 72 THR n 1 73 LYS n 1 74 THR n 1 75 ILE n 1 76 ASN n 1 77 GLU n 1 78 GLY n 1 79 GLN n 1 80 THR n 1 81 ILE n 1 82 LEU n 1 83 VAL n 1 84 VAL n 1 85 PHE n 1 86 ASN n 1 87 GLU n 1 88 GLY n 1 89 TYR n 1 90 ALA n 1 91 PRO n 1 92 ASP n 1 93 GLY n 1 94 VAL n 1 95 TRP n 1 96 LEU n 1 97 GLY n 1 98 GLY n 1 99 THR n 1 100 LYS n 1 101 TYR n 1 102 GLN n 1 103 PHE n 1 104 ILE n 1 105 ASN n 1 106 ILE n 1 107 GLU n 1 108 ARG n 1 109 ASP n 1 110 LEU n 1 111 GLU n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 TYR n 1 116 ASN n 1 117 PHE n 1 118 ASP n 1 119 VAL n 1 120 ALA n 1 121 THR n 1 122 CYS n 1 123 ALA n 1 124 LYS n 1 125 LEU n 1 126 LYS n 1 127 GLY n 1 128 GLY n 1 129 LEU n 1 130 HIS n 1 131 LEU n 1 132 VAL n 1 133 LYS n 1 134 VAL n 1 135 PRO n 1 136 GLY n 1 137 GLY n 1 138 ASN n 1 139 ILE n 1 140 LEU n 1 141 VAL n 1 142 VAL n 1 143 LEU n 1 144 TYR n 1 145 ASP n 1 146 GLU n 1 147 GLU n 1 148 LYS n 1 149 GLU n 1 150 GLN n 1 151 ASP n 1 152 ARG n 1 153 GLY n 1 154 ASN n 1 155 SER n 1 156 LYS n 1 157 ILE n 1 158 ALA n 1 159 ALA n 1 160 LEU n 1 161 THR n 1 162 PHE n 1 163 ALA n 1 164 LYS n 1 165 GLU n 1 166 LEU n 1 167 ALA n 1 168 GLU n 1 169 SER n 1 170 SER n 1 171 GLN n 1 172 LEU n 1 173 GLN n 1 174 HIS n 1 175 HIS n 1 176 HIS n 1 177 HIS n 1 178 HIS n 1 179 HIS n 2 1 PRO n 2 2 PRO n 2 3 PRO n 2 4 PRO n 2 5 PRO n 2 6 PRO n 2 7 PRO n 2 8 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'PLASMODIUM FALCIPARUM' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5833 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description CODONPLUSRIPL # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'SYNTHETIC CONSTRUCT' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP Q8I2J4_PLAF7 1 ? ? Q8I2J4 ? 2 PDB 2JKG 2 ? ? 2JKG ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2JKG A 1 ? 171 ? Q8I2J4 1 ? 171 ? 1 171 2 2 2JKG P 1 ? 8 ? 2JKG 0 ? 7 ? 0 7 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JKG LEU A 172 ? UNP Q8I2J4 ? ? 'expression tag' 172 1 1 2JKG GLN A 173 ? UNP Q8I2J4 ? ? 'expression tag' 173 2 1 2JKG HIS A 174 ? UNP Q8I2J4 ? ? 'expression tag' 174 3 1 2JKG HIS A 175 ? UNP Q8I2J4 ? ? 'expression tag' 175 4 1 2JKG HIS A 176 ? UNP Q8I2J4 ? ? 'expression tag' 176 5 1 2JKG HIS A 177 ? UNP Q8I2J4 ? ? 'expression tag' 177 6 1 2JKG HIS A 178 ? UNP Q8I2J4 ? ? 'expression tag' 178 7 1 2JKG HIS A 179 ? UNP Q8I2J4 ? ? 'expression tag' 179 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2JKG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.3 _exptl_crystal.density_percent_sol 46 _exptl_crystal.description NONE _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '80 % TACSIMATE, PH 5' # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 100 ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD 'MARMOSAIC 225 mm CCD' ? 'RH-COATED SI MIRRORS' 2 ? ? ? ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M 'SI(111) DOUBLE CRYSTAL MONOCHROMATOR' 'SINGLE WAVELENGTH' x-ray 2 1 M ? MAD x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.0 1.0 2 0.9193 1.0 3 0.9196 1.0 4 0.8856 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'MAX II BEAMLINE I911-3' 'MAX II' I911-3 1.0 ? 2 SYNCHROTRON 'EMBL/DESY, HAMBURG BEAMLINE BW7A' 'EMBL/DESY, HAMBURG' BW7A ? '0.9193, 0.9196, 0.8856' # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2JKG _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.00 _reflns.d_resolution_high 1.89 _reflns.number_obs 15675 _reflns.number_all ? _reflns.percent_possible_obs 98.7 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.60 _reflns.B_iso_Wilson_estimate 35.00 _reflns.pdbx_redundancy 5.9 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.89 _reflns_shell.d_res_low 1.94 _reflns_shell.percent_possible_all 89.1 _reflns_shell.Rmerge_I_obs 0.61 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.50 _reflns_shell.pdbx_redundancy 3.6 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2JKG _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.ls_number_reflns_obs 14883 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.89 _refine.ls_percent_reflns_obs 98.9 _refine.ls_R_factor_obs 0.178 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.176 _refine.ls_R_factor_R_free 0.217 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 783 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.949 _refine.B_iso_mean 15.70 _refine.aniso_B[1][1] -2.19000 _refine.aniso_B[2][2] -1.78000 _refine.aniso_B[3][3] 3.97000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ATOM RECORD CONTAINS RESIDUAL B FACTORS ONLY.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.136 _refine.pdbx_overall_ESU_R_Free 0.131 _refine.overall_SU_ML 0.094 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 7.187 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1351 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 100 _refine_hist.number_atoms_total 1452 _refine_hist.d_res_high 1.89 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.014 0.022 ? 1384 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 916 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.533 1.966 ? 1881 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.515 3.000 ? 2249 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 16.237 5.000 ? 171 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.655 26.232 ? 69 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.642 15.000 ? 218 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 10.113 15.000 ? 3 'X-RAY DIFFRACTION' ? r_chiral_restr 0.092 0.200 ? 201 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.009 0.021 ? 1563 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.003 0.020 ? 261 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.106 2.000 ? 813 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.974 3.000 ? 1298 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.368 4.000 ? 509 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.620 5.000 ? 494 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.89 _refine_ls_shell.d_res_low 1.94 _refine_ls_shell.number_reflns_R_work 959 _refine_ls_shell.R_factor_R_work 0.3050 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2950 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 50 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2JKG _struct.title 'Plasmodium falciparum profilin' _struct.pdbx_descriptor 'PROFILIN, OCTAPROLINE PEPTIDE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JKG _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'PROLINE-RICH LIGAND, PROTEIN-BINDING, MALARIA, CYTOSKELETON, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? LEU A 15 ? SER A 6 LEU A 15 1 ? 10 HELX_P HELX_P2 2 LEU A 16 ? ASN A 19 ? LEU A 16 ASN A 19 5 ? 4 HELX_P HELX_P3 3 ASP A 49 ? PHE A 54 ? ASP A 49 PHE A 54 5 ? 6 HELX_P HELX_P4 4 ASN A 76 ? GLY A 88 ? ASN A 76 GLY A 88 1 ? 13 HELX_P HELX_P5 5 GLU A 147 ? GLU A 149 ? GLU A 147 GLU A 149 5 ? 3 HELX_P HELX_P6 6 ASP A 151 ? SER A 169 ? ASP A 151 SER A 169 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C MG . MG ? ? ? 1_555 A ARG 108 O ? ? A MG 1170 A ARG 108 4_455 ? ? ? ? ? ? ? 2.327 ? metalc2 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1170 A HOH 2069 4_455 ? ? ? ? ? ? ? 2.275 ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 A PRO 91 O ? ? A MG 1170 A PRO 91 1_555 ? ? ? ? ? ? ? 2.144 ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1170 A HOH 2070 4_455 ? ? ? ? ? ? ? 2.509 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 43 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 43 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 44 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 44 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -13.42 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 7 ? AB ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AB 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 34 ? ALA A 39 ? VAL A 34 ALA A 39 AA 2 GLY A 23 ? SER A 28 ? GLY A 23 SER A 28 AA 3 ASN A 138 ? ASP A 145 ? ASN A 138 ASP A 145 AA 4 GLY A 127 ? VAL A 134 ? GLY A 127 VAL A 134 AA 5 TYR A 115 ? LYS A 124 ? TYR A 115 LYS A 124 AA 6 THR A 99 ? PHE A 112 ? THR A 99 PHE A 112 AA 7 VAL A 94 ? LEU A 96 ? VAL A 94 LEU A 96 AB 1 TYR A 59 ? GLU A 64 ? TYR A 59 GLU A 64 AB 2 LYS A 70 ? ILE A 75 ? LYS A 70 ILE A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N VAL A 38 ? N VAL A 38 O ALA A 24 ? O ALA A 24 AA 2 3 N ALA A 27 ? N ALA A 27 O ILE A 139 ? O ILE A 139 AA 3 4 N TYR A 144 ? N TYR A 144 O GLY A 128 ? O GLY A 128 AA 4 5 N LYS A 133 ? N LYS A 133 O ASP A 118 ? O ASP A 118 AA 5 6 N ALA A 123 ? N ALA A 123 O GLN A 102 ? O GLN A 102 AA 6 7 N TYR A 101 ? N TYR A 101 O VAL A 94 ? O VAL A 94 AB 1 2 N VAL A 63 ? N VAL A 63 O THR A 71 ? O THR A 71 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE MG A 1170' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 PRO A 91 ? PRO A 91 . ? 1_555 ? 2 AC1 5 ASP A 92 ? ASP A 92 . ? 1_555 ? 3 AC1 5 ARG A 108 ? ARG A 108 . ? 4_455 ? 4 AC1 5 HOH D . ? HOH A 2069 . ? 4_455 ? 5 AC1 5 HOH D . ? HOH A 2070 . ? 4_455 ? # _database_PDB_matrix.entry_id 2JKG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2JKG _atom_sites.fract_transf_matrix[1][1] 0.021968 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020121 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011932 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 TRP 95 95 95 TRP TRP A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 SER 170 170 ? ? ? A . n A 1 171 GLN 171 171 ? ? ? A . n A 1 172 LEU 172 172 ? ? ? A . n A 1 173 GLN 173 173 ? ? ? A . n A 1 174 HIS 174 174 ? ? ? A . n A 1 175 HIS 175 175 ? ? ? A . n A 1 176 HIS 176 176 ? ? ? A . n A 1 177 HIS 177 177 ? ? ? A . n A 1 178 HIS 178 178 ? ? ? A . n A 1 179 HIS 179 179 ? ? ? A . n B 2 1 PRO 1 0 0 PRO PRO P . n B 2 2 PRO 2 1 1 PRO PRO P . n B 2 3 PRO 3 2 2 PRO PRO P . n B 2 4 PRO 4 3 3 PRO PRO P . n B 2 5 PRO 5 4 4 PRO PRO P . n B 2 6 PRO 6 5 5 PRO PRO P . n B 2 7 PRO 7 6 6 PRO PRO P . n B 2 8 PRO 8 7 7 PRO PRO P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MG 1 1170 1170 MG MG A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . E 4 HOH 1 2001 2001 HOH HOH P . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 730 ? 1 MORE -9.2 ? 1 'SSA (A^2)' 11270 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ARG 108 ? A ARG 108 ? 4_455 MG ? C MG . ? A MG 1170 ? 1_555 O ? D HOH . ? A HOH 2069 ? 4_455 92.8 ? 2 O ? A ARG 108 ? A ARG 108 ? 4_455 MG ? C MG . ? A MG 1170 ? 1_555 O ? A PRO 91 ? A PRO 91 ? 1_555 118.0 ? 3 O ? D HOH . ? A HOH 2069 ? 4_455 MG ? C MG . ? A MG 1170 ? 1_555 O ? A PRO 91 ? A PRO 91 ? 1_555 95.8 ? 4 O ? A ARG 108 ? A ARG 108 ? 4_455 MG ? C MG . ? A MG 1170 ? 1_555 O ? D HOH . ? A HOH 2070 ? 4_455 96.6 ? 5 O ? D HOH . ? A HOH 2069 ? 4_455 MG ? C MG . ? A MG 1170 ? 1_555 O ? D HOH . ? A HOH 2070 ? 4_455 152.4 ? 6 O ? A PRO 91 ? A PRO 91 ? 1_555 MG ? C MG . ? A MG 1170 ? 1_555 O ? D HOH . ? A HOH 2070 ? 4_455 102.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2016-12-21 4 'Structure model' 1 3 2018-01-17 5 'Structure model' 1 4 2019-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Source and taxonomy' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Data collection' 7 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_radiation 2 4 'Structure model' diffrn_source 3 5 'Structure model' diffrn_source # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_radiation.pdbx_diffrn_protocol' 2 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 10.6100 -6.0040 7.2500 0.2567 0.1951 0.2353 0.0228 0.0512 0.0463 3.7546 3.9060 2.2846 -0.1504 0.5433 0.4911 -0.0889 0.0864 -0.5081 -0.0193 -0.0005 -0.5168 0.2491 0.2400 0.0895 'X-RAY DIFFRACTION' 2 ? refined 8.6720 -9.4440 23.1230 0.2893 0.2997 0.2502 -0.0146 -0.0279 0.2097 4.8122 22.2590 34.9703 0.7280 0.3632 -2.5994 -0.3463 -0.8561 -1.3369 -0.1036 -0.8134 -0.5778 0.3662 1.0824 1.1597 'X-RAY DIFFRACTION' 3 ? refined -5.7220 -5.0110 12.8320 0.2812 0.2514 0.1758 -0.0490 0.0776 0.0509 8.6889 4.8547 1.9948 -4.2276 2.2634 -0.6438 -0.1922 -0.4097 -0.5255 0.1577 0.1526 0.4916 0.4382 -0.3186 0.0396 'X-RAY DIFFRACTION' 4 ? refined -21.0640 10.6600 11.8160 0.0897 0.2970 0.2658 -0.0976 -0.0983 -0.0668 6.6179 39.8402 1.6995 -6.0942 1.9336 -0.3267 -0.2150 -0.1326 -0.0791 0.1535 -0.3102 -1.0402 -0.6851 0.0465 0.5251 'X-RAY DIFFRACTION' 5 ? refined -4.0030 5.8770 3.9320 0.2507 0.2487 0.1685 -0.0084 -0.0033 -0.0149 2.2032 1.7562 2.3633 -0.7656 -0.4342 -0.5482 -0.0528 0.0402 0.0079 -0.0136 -0.0053 0.0786 0.1020 -0.1501 0.0582 'X-RAY DIFFRACTION' 6 ? refined 8.7280 5.4560 3.1940 0.2675 0.2576 0.1809 0.0196 -0.0107 -0.0001 3.5040 1.7066 1.6042 1.4416 -0.7091 -0.4618 -0.1843 0.1351 -0.0954 -0.0288 0.1378 -0.2525 0.1115 -0.0785 0.0465 'X-RAY DIFFRACTION' 7 ? refined 13.1650 6.6180 11.4270 0.2492 0.2876 0.2033 -0.0051 -0.0592 0.0299 5.3529 4.0373 7.9548 -1.7988 -3.8741 1.4679 -0.1443 -0.5639 0.0261 0.3621 -0.0055 -0.3446 -0.1532 0.3389 0.1499 'X-RAY DIFFRACTION' 8 ? refined 19.4420 -4.2640 -4.5500 0.3465 0.2293 0.3318 0.1060 0.1823 -0.0927 35.0809 48.7579 4.9403 11.2922 7.5117 -2.2039 1.0013 2.1031 -2.1815 -2.7923 -0.7334 -1.4244 0.7371 1.8695 -0.2680 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 5 ? ? A 38 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 39 ? ? A 48 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 49 ? ? A 62 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 63 ? ? A 73 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 74 ? ? A 108 ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 109 ? ? A 144 ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 145 ? ? A 164 ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 165 ? ? A 169 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement 5.4.0077 ? 1 ? ? ? ? XDS 'data reduction' . ? 2 ? ? ? ? XSCALE 'data scaling' . ? 3 ? ? ? ? Auto-Rickshaw phasing . ? 4 ? ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG A SER 28 ? ? OE1 A GLU 30 ? ? 2.02 2 1 O A HOH 2051 ? ? O A HOH 2058 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 N _pdbx_validate_symm_contact.auth_asym_id_1 P _pdbx_validate_symm_contact.auth_comp_id_1 PRO _pdbx_validate_symm_contact.auth_seq_id_1 0 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 C _pdbx_validate_symm_contact.auth_asym_id_2 P _pdbx_validate_symm_contact.auth_comp_id_2 PRO _pdbx_validate_symm_contact.auth_seq_id_2 7 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_445 _pdbx_validate_symm_contact.dist 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 15 ? ? -133.07 -52.18 2 1 GLU A 42 ? ? -93.22 55.16 3 1 GLU A 43 ? ? -34.81 120.70 4 1 ASP A 45 ? ? 3.71 104.48 5 1 ASN A 47 ? ? -143.98 -1.87 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 SER A 44 ? ? ASP A 45 ? ? 66.81 2 1 ASP A 45 ? ? PRO A 46 ? ? -138.52 3 1 PRO A 46 ? ? ASN A 47 ? ? -123.81 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A SER 170 ? A SER 170 6 1 Y 1 A GLN 171 ? A GLN 171 7 1 Y 1 A LEU 172 ? A LEU 172 8 1 Y 1 A GLN 173 ? A GLN 173 9 1 Y 1 A HIS 174 ? A HIS 174 10 1 Y 1 A HIS 175 ? A HIS 175 11 1 Y 1 A HIS 176 ? A HIS 176 12 1 Y 1 A HIS 177 ? A HIS 177 13 1 Y 1 A HIS 178 ? A HIS 178 14 1 Y 1 A HIS 179 ? A HIS 179 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'MAGNESIUM ION' MG 4 water HOH #