data_2JM4 # _entry.id 2JM4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.348 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JM4 pdb_00002jm4 10.2210/pdb2jm4/pdb RCSB RCSB100004 ? ? WWPDB D_1000100004 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 7321 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site ? _pdbx_database_status.entry_id 2JM4 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-10-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hopkins, E.J.' 1 'Bathgate, R.A.D.' 2 'Gooley, P.R.' 3 # _citation.id primary _citation.title ;The NMR solution structure of the relaxin (RXFP1) receptor lipoprotein receptor class A module and identification of key residues in the N-terminal region of the module that mediate receptor activation ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 4172 _citation.page_last 4184 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17148455 _citation.pdbx_database_id_DOI 10.1074/jbc.M609526200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hopkins, E.J.' 1 ? primary 'Layfield, S.' 2 ? primary 'Ferraro, T.' 3 ? primary 'Bathgate, R.A.D.' 4 ? primary 'Gooley, P.R.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Relaxin receptor 1' 4536.005 1 ? ? 'LDL-receptor class A, residues 23-63' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Relaxin family peptide receptor 1, Leucine-rich repeat-containing G-protein coupled receptor 7, LDLa module' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADEDNCG _entity_poly.pdbx_seq_one_letter_code_can GSQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADEDNCG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLN n 1 4 ASP n 1 5 VAL n 1 6 LYS n 1 7 CYS n 1 8 SER n 1 9 LEU n 1 10 GLY n 1 11 TYR n 1 12 PHE n 1 13 PRO n 1 14 CYS n 1 15 GLY n 1 16 ASN n 1 17 ILE n 1 18 THR n 1 19 LYS n 1 20 CYS n 1 21 LEU n 1 22 PRO n 1 23 GLN n 1 24 LEU n 1 25 LEU n 1 26 HIS n 1 27 CYS n 1 28 ASN n 1 29 GLY n 1 30 VAL n 1 31 ASP n 1 32 ASP n 1 33 CYS n 1 34 GLY n 1 35 ASN n 1 36 GLN n 1 37 ALA n 1 38 ASP n 1 39 GLU n 1 40 ASP n 1 41 ASN n 1 42 CYS n 1 43 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'RXFP1, LGR7' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K12 _entity_src_gen.pdbx_host_org_variant trxB _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEV-LDLa _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RXFP1_HUMAN _struct_ref.pdbx_db_accession Q9HBX9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADEDNCG _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JM4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HBX9 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 63 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 43 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JM4 GLY A 1 ? UNP Q9HBX9 ? ? 'cloning artifact' 1 1 1 2JM4 SER A 2 ? UNP Q9HBX9 ? ? 'cloning artifact' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '3D HNCO' 1 2 2 '3D HNCA' 1 3 2 '3D HNCACB' 1 4 2 '3D CBCA(CO)NH' 1 5 2 '3D HBHA(CO)NH' 1 6 2 '3D C(CO)NH' 1 7 2 '3D H(CCO)NH' 1 8 1 '2D 1H-15N HSQC' 1 9 2 '2D 1H-15N HSQC' 1 10 2 '3D HCCH-TOCSY' 1 11 1 '3D HNHA' 1 12 1 '3D 1H-15N NOESY' 1 13 2 '3D 1H-13C NOESY' 1 14 1 '3D HNHB' 1 15 2 '3D HACAHB' 1 16 2 '2D 1H-13C HSQC' 1 17 3 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303.15 _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details '1.0 mM 15N RXFP1-LDLa, 10 mM calcium chloride, 50 mM acetic acid, 90% H2O, 10% D2O, pH 5.5 (adjusted with NaOH)' 1 '90% H2O/10% D2O' sample_1 solution ? '1.5 mM 13C, 15N RXFP1-LDLa, 10 mM calcium chloride, 50 mM acetic acid, 90% H2O, 10% D2O, pH 5.5 (adjusted with NaOH)' 2 '90% H2O/10% D2O' sample_2 solution ? '1.0 mM 10% 13C, 90% 12C RXFP1-LDLa, 10 mM calcium chloride, 50 mM acetic acid, 90% H2O, 10% D2O, pH 5.5 (adjusted with NaOH)' 3 '90% H2O/10% D2O' sample_3 solution ? # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 2JM4 _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 24 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JM4 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 2.7 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.27 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JM4 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Goddard 'data analysis' Sparky 3.106 1 Delaglio,Grzesiek,Vuister,Zhu,Pfeifer,Bax processing NMRPipe 2.3 2 'Schwieters, Kuszewski, Tjandra, Clore' refinement 'X-PLOR NIH' 2.9.9 3 Guntert,Mumenthaler,Wuthrich 'structure solution' CYANA 1.0.7 4 Johnson 'data analysis' NMRView 5.2.2 5 'Laskowski, MacArthur' refinement ProcheckNMR 3.5.4 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JM4 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JM4 _struct.title 'The solution NMR structure of the relaxin (RXFP1) receptor LDLa module.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JM4 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'LDL-A module, RXFP1 receptor, LGR7, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 24 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 26 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 24 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 26 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 7 A CYS 20 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 14 A CYS 33 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 27 A CYS 42 1_555 ? ? ? ? ? ? ? 2.020 ? ? metalc1 metalc ? ? A LEU 25 O ? ? ? 1_555 B CA . CA ? ? A LEU 25 A CA 44 1_555 ? ? ? ? ? ? ? 2.645 ? ? metalc2 metalc ? ? A ASN 28 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 28 A CA 44 1_555 ? ? ? ? ? ? ? 2.662 ? ? metalc3 metalc ? ? A VAL 30 O ? ? ? 1_555 B CA . CA ? ? A VAL 30 A CA 44 1_555 ? ? ? ? ? ? ? 2.642 ? ? metalc4 metalc ? ? A ASP 32 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 32 A CA 44 1_555 ? ? ? ? ? ? ? 2.660 ? ? metalc5 metalc ? ? A ASP 38 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 38 A CA 44 1_555 ? ? ? ? ? ? ? 2.634 ? ? metalc6 metalc ? ? A GLU 39 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 39 A CA 44 1_555 ? ? ? ? ? ? ? 2.638 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? PRO A 13 ? TYR A 11 PRO A 13 A 2 CYS A 20 ? PRO A 22 ? CYS A 20 PRO A 22 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 12 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 12 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 21 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 21 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 44 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 44' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LEU A 25 ? LEU A 25 . ? 1_555 ? 2 AC1 6 ASN A 28 ? ASN A 28 . ? 1_555 ? 3 AC1 6 VAL A 30 ? VAL A 30 . ? 1_555 ? 4 AC1 6 ASP A 32 ? ASP A 32 . ? 1_555 ? 5 AC1 6 ASP A 38 ? ASP A 38 . ? 1_555 ? 6 AC1 6 GLU A 39 ? GLU A 39 . ? 1_555 ? # _atom_sites.entry_id 2JM4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 44 _pdbx_nonpoly_scheme.auth_seq_num 44 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A LEU 25 ? A LEU 25 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OD1 ? A ASN 28 ? A ASN 28 ? 1_555 73.6 ? 2 O ? A LEU 25 ? A LEU 25 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 O ? A VAL 30 ? A VAL 30 ? 1_555 148.2 ? 3 OD1 ? A ASN 28 ? A ASN 28 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 O ? A VAL 30 ? A VAL 30 ? 1_555 88.2 ? 4 O ? A LEU 25 ? A LEU 25 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OD2 ? A ASP 32 ? A ASP 32 ? 1_555 84.4 ? 5 OD1 ? A ASN 28 ? A ASN 28 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OD2 ? A ASP 32 ? A ASP 32 ? 1_555 102.4 ? 6 O ? A VAL 30 ? A VAL 30 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OD2 ? A ASP 32 ? A ASP 32 ? 1_555 74.1 ? 7 O ? A LEU 25 ? A LEU 25 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OD2 ? A ASP 38 ? A ASP 38 ? 1_555 95.7 ? 8 OD1 ? A ASN 28 ? A ASN 28 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OD2 ? A ASP 38 ? A ASP 38 ? 1_555 169.0 ? 9 O ? A VAL 30 ? A VAL 30 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OD2 ? A ASP 38 ? A ASP 38 ? 1_555 102.5 ? 10 OD2 ? A ASP 32 ? A ASP 32 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OD2 ? A ASP 38 ? A ASP 38 ? 1_555 78.5 ? 11 O ? A LEU 25 ? A LEU 25 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 102.9 ? 12 OD1 ? A ASN 28 ? A ASN 28 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 80.8 ? 13 O ? A VAL 30 ? A VAL 30 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 99.5 ? 14 OD2 ? A ASP 32 ? A ASP 32 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 172.6 ? 15 OD2 ? A ASP 38 ? A ASP 38 ? 1_555 CA ? B CA . ? A CA 44 ? 1_555 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 99.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-12 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-08-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' diffrn 3 4 'Structure model' diffrn_radiation 4 4 'Structure model' diffrn_radiation_wavelength 5 4 'Structure model' pdbx_nmr_exptl_sample 6 4 'Structure model' pdbx_nmr_sample_details 7 4 'Structure model' pdbx_nmr_software 8 4 'Structure model' pdbx_struct_assembly 9 4 'Structure model' pdbx_struct_conn_angle 10 4 'Structure model' pdbx_struct_oper_list 11 4 'Structure model' struct_conn 12 4 'Structure model' struct_ref_seq_dif 13 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_sample_details.label' 4 4 'Structure model' '_pdbx_nmr_sample_details.type' 5 4 'Structure model' '_pdbx_nmr_software.name' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.concentration_range RXFP1-LDLa 1.0 mM '[U-15N]' 1 ? RXFP1-LDLa 1.5 mM '[U-13C; U-15N]' 2 ? RXFP1-LDLa 1.0 mM '[U-10% 13C]' 3 ? 'calcium chloride' 10 mM 'natural abundance' 1 ? 'calcium chloride' 10 mM 'natural abundance' 2 ? 'calcium chloride' 10 mM 'natural abundance' 3 ? 'acetic acid' 50 mM 'natural abundance' 1 ? 'acetic acid' 50 mM 'natural abundance' 2 ? 'acetic acid' 50 mM 'natural abundance' 3 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 32 ? ? H A CYS 33 ? ? 1.59 2 5 OD1 A ASN 35 ? ? H A GLN 36 ? ? 1.47 3 6 OD1 A ASN 35 ? ? H A GLN 36 ? ? 1.52 4 14 O A GLY 1 ? ? H A GLN 3 ? ? 1.51 5 19 OD1 A ASP 32 ? ? H A CYS 33 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 6 ? ? 49.81 179.05 2 1 LYS A 19 ? ? -171.76 145.94 3 1 ASP A 32 ? ? -145.90 -52.35 4 2 SER A 2 ? ? 48.49 93.84 5 2 GLN A 3 ? ? 46.29 -114.90 6 2 ASP A 4 ? ? 52.39 -122.22 7 2 ASP A 32 ? ? -146.93 -54.26 8 2 CYS A 42 ? ? -150.79 -3.11 9 3 GLN A 3 ? ? -172.34 -52.52 10 3 CYS A 27 ? ? 50.83 87.82 11 3 ASP A 40 ? ? -81.75 49.17 12 3 ASN A 41 ? ? -172.15 22.33 13 4 SER A 2 ? ? 50.46 -178.53 14 4 ASP A 32 ? ? -145.33 -52.99 15 4 CYS A 42 ? ? -144.45 -32.41 16 5 LYS A 19 ? ? -170.03 122.09 17 5 ASP A 32 ? ? -132.91 -43.21 18 5 ASN A 35 ? ? -149.37 -92.75 19 5 GLN A 36 ? ? -176.85 22.76 20 5 ASP A 40 ? ? -54.16 -172.26 21 5 CYS A 42 ? ? 50.92 77.44 22 6 LYS A 6 ? ? -62.04 -127.58 23 6 ASP A 32 ? ? -144.49 -51.77 24 6 ASN A 35 ? ? -149.46 -92.17 25 6 GLN A 36 ? ? -176.10 22.67 26 7 ASP A 32 ? ? -148.49 -53.16 27 7 ASN A 41 ? ? 38.64 90.08 28 8 ASP A 4 ? ? 50.05 -125.03 29 8 PRO A 22 ? ? -44.49 152.54 30 8 ASP A 32 ? ? -148.27 -54.69 31 9 SER A 2 ? ? 50.72 98.23 32 9 GLN A 3 ? ? 54.79 73.45 33 9 ASP A 32 ? ? -142.40 -52.52 34 9 GLN A 36 ? ? 59.51 18.39 35 10 VAL A 5 ? ? -62.22 -136.34 36 10 LYS A 6 ? ? 51.07 -153.67 37 10 LYS A 19 ? ? -171.24 149.54 38 10 ASN A 41 ? ? 39.62 84.33 39 11 SER A 2 ? ? 51.49 -150.37 40 11 LYS A 6 ? ? 44.80 -129.90 41 12 SER A 2 ? ? -160.94 -23.57 42 12 GLN A 3 ? ? -151.82 86.73 43 12 LYS A 6 ? ? -157.81 -130.86 44 12 ASN A 16 ? ? 54.70 19.59 45 12 ASP A 32 ? ? -122.28 -51.94 46 12 ASP A 40 ? ? -50.28 173.25 47 12 ASN A 41 ? ? -46.63 91.35 48 13 SER A 2 ? ? 47.20 -123.73 49 13 LYS A 6 ? ? 50.46 179.53 50 13 SER A 8 ? ? -68.94 -177.83 51 13 PRO A 22 ? ? -45.04 152.69 52 13 ASP A 32 ? ? -139.29 -51.22 53 13 ASP A 40 ? ? -60.54 -170.78 54 13 ASN A 41 ? ? -46.52 -17.04 55 13 CYS A 42 ? ? 51.20 -89.70 56 14 SER A 2 ? ? 67.08 -43.67 57 14 LYS A 6 ? ? -154.06 45.48 58 14 ASN A 35 ? ? -90.25 -89.49 59 14 GLN A 36 ? ? -173.17 23.19 60 14 ASN A 41 ? ? -58.32 92.06 61 15 GLN A 3 ? ? 53.60 90.45 62 15 ASP A 40 ? ? -56.44 -171.13 63 15 ASN A 41 ? ? -46.88 -18.87 64 16 CYS A 27 ? ? 51.71 79.68 65 16 ASN A 28 ? ? -143.28 -3.77 66 16 ASP A 32 ? ? -138.16 -51.80 67 16 ASN A 35 ? ? -136.22 -99.66 68 16 GLN A 36 ? ? -155.93 15.36 69 16 ASP A 40 ? ? 44.79 -166.84 70 16 CYS A 42 ? ? 47.46 -172.91 71 17 LYS A 6 ? ? -97.02 33.95 72 17 ASN A 16 ? ? 68.01 -25.95 73 17 GLN A 36 ? ? 48.67 13.69 74 17 ASP A 40 ? ? -63.25 77.09 75 17 CYS A 42 ? ? 46.79 -92.82 76 18 SER A 2 ? ? 53.12 6.50 77 18 ASP A 32 ? ? -144.15 -52.50 78 18 ASP A 40 ? ? -88.87 47.92 79 18 ASN A 41 ? ? -161.22 19.18 80 19 SER A 2 ? ? 49.31 -176.30 81 19 SER A 8 ? ? -88.35 -157.87 82 19 LEU A 9 ? ? 57.81 -168.60 83 19 ASP A 32 ? ? -146.92 -58.53 84 20 SER A 2 ? ? 49.63 -177.49 85 20 GLN A 3 ? ? -140.36 29.09 86 20 CYS A 14 ? ? -88.37 47.23 87 20 GLN A 36 ? ? 48.85 19.56 88 20 ASN A 41 ? ? -171.19 23.41 89 21 GLN A 3 ? ? -159.33 10.99 90 21 ASP A 32 ? ? -138.38 -60.48 91 21 GLN A 36 ? ? 48.23 18.54 92 21 CYS A 42 ? ? -150.60 -8.16 93 22 GLN A 3 ? ? 45.73 -116.34 94 22 LYS A 6 ? ? -165.99 45.27 95 22 ASP A 32 ? ? -143.78 -47.77 96 22 ASN A 35 ? ? -140.61 13.18 97 22 CYS A 42 ? ? -146.53 -2.82 98 23 LYS A 6 ? ? 65.17 112.23 99 23 ASN A 41 ? ? 39.77 80.91 100 24 SER A 2 ? ? 49.11 -175.65 101 24 VAL A 5 ? ? 50.90 97.27 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #