data_2JM9
# 
_entry.id   2JM9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2JM9         pdb_00002jm9 10.2210/pdb2jm9/pdb 
RCSB  RCSB100009   ?            ?                   
WWPDB D_1000100009 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-04-24 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-20 
5 'Structure model' 1 4 2023-12-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_software     
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
5 4 'Structure model' struct_ref_seq_dif    
6 5 'Structure model' chem_comp_atom        
7 5 'Structure model' chem_comp_bond        
8 5 'Structure model' pdbx_database_status  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_struct_ref_seq_dif.details'         
5 5 'Structure model' '_pdbx_database_status.deposit_site'  
# 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.entry_id                        2JM9 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-25 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
2jm8 PDB  'R21A Spc-SH3 free'        unspecified 
2jmA PDB  'R21A Spc-SH3:P41 complex' unspecified 
7305 BMRB 'R21A Spc-SH3 free'        unspecified 
7306 BMRB 'R21A Spc-SH3 bound'       unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'van Nuland, N.A.J.' 1 
'Casares, S.'        2 
'Ab, E.'             3 
'Eshuis, H.'         4 
'Lopez-Mayorga, O.'  5 
'Conejero-Lara, F.'  6 
# 
_citation.id                        primary 
_citation.title                     
;The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
;
_citation.journal_abbrev            'Bmc Struct.Biol.' 
_citation.journal_volume            7 
_citation.page_first                22 
_citation.page_last                 22 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1472-6807 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17407569 
_citation.pdbx_database_id_DOI      10.1186/1472-6807-7-22 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Casares, S.'        1 ? 
primary 'Ab, E.'             2 ? 
primary 'Eshuis, H.'         3 ? 
primary 'Lopez-Mayorga, O.'  4 ? 
primary 'van Nuland, N.A.J.' 5 ? 
primary 'Conejero-Lara, F.'  6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Spectrin alpha chain, brain' 
_entity.formula_weight             7143.128 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              R21A 
_entity.pdbx_fragment              'SH3 domain, residues 965-1025' 
_entity.details                    ? 
# 
_entity_keywords.entity_id   1 
_entity_keywords.text        'SRC-HOMOLOGY 3 DOMAIN' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Spectrin, non-erythroid alpha chain, Fodrin alpha chain, alpha spectrin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 
_entity_poly.pdbx_seq_one_letter_code_can   MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  GLU n 
1 4  THR n 
1 5  GLY n 
1 6  LYS n 
1 7  GLU n 
1 8  LEU n 
1 9  VAL n 
1 10 LEU n 
1 11 ALA n 
1 12 LEU n 
1 13 TYR n 
1 14 ASP n 
1 15 TYR n 
1 16 GLN n 
1 17 GLU n 
1 18 LYS n 
1 19 SER n 
1 20 PRO n 
1 21 ALA n 
1 22 GLU n 
1 23 VAL n 
1 24 THR n 
1 25 MET n 
1 26 LYS n 
1 27 LYS n 
1 28 GLY n 
1 29 ASP n 
1 30 ILE n 
1 31 LEU n 
1 32 THR n 
1 33 LEU n 
1 34 LEU n 
1 35 ASN n 
1 36 SER n 
1 37 THR n 
1 38 ASN n 
1 39 LYS n 
1 40 ASP n 
1 41 TRP n 
1 42 TRP n 
1 43 LYS n 
1 44 VAL n 
1 45 GLU n 
1 46 VAL n 
1 47 ASN n 
1 48 ASP n 
1 49 ARG n 
1 50 GLN n 
1 51 GLY n 
1 52 PHE n 
1 53 VAL n 
1 54 PRO n 
1 55 ALA n 
1 56 ALA n 
1 57 TYR n 
1 58 VAL n 
1 59 LYS n 
1 60 LYS n 
1 61 LEU n 
1 62 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               chicken 
_entity_src_gen.gene_src_genus                     Gallus 
_entity_src_gen.pdbx_gene_src_gene                 'SPTAN1, SPTA2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Gallus gallus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9031 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET3d 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ASP 2  2  2  ASP ASP A . n 
A 1 3  GLU 3  3  3  GLU GLU A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  GLY 5  5  5  GLY GLY A . n 
A 1 6  LYS 6  6  6  LYS LYS A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  LEU 8  8  8  LEU LEU A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 TYR 13 13 13 TYR TYR A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 TYR 15 15 15 TYR TYR A . n 
A 1 16 GLN 16 16 16 GLN GLN A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 LYS 18 18 18 LYS LYS A . n 
A 1 19 SER 19 19 19 SER SER A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 THR 24 24 24 THR THR A . n 
A 1 25 MET 25 25 25 MET MET A . n 
A 1 26 LYS 26 26 26 LYS LYS A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 ASP 29 29 29 ASP ASP A . n 
A 1 30 ILE 30 30 30 ILE ILE A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 THR 32 32 32 THR THR A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 ASN 35 35 35 ASN ASN A . n 
A 1 36 SER 36 36 36 SER SER A . n 
A 1 37 THR 37 37 37 THR THR A . n 
A 1 38 ASN 38 38 38 ASN ASN A . n 
A 1 39 LYS 39 39 39 LYS LYS A . n 
A 1 40 ASP 40 40 40 ASP ASP A . n 
A 1 41 TRP 41 41 41 TRP TRP A . n 
A 1 42 TRP 42 42 42 TRP TRP A . n 
A 1 43 LYS 43 43 43 LYS LYS A . n 
A 1 44 VAL 44 44 44 VAL VAL A . n 
A 1 45 GLU 45 45 45 GLU GLU A . n 
A 1 46 VAL 46 46 46 VAL VAL A . n 
A 1 47 ASN 47 47 47 ASN ASN A . n 
A 1 48 ASP 48 48 48 ASP ASP A . n 
A 1 49 ARG 49 49 49 ARG ARG A . n 
A 1 50 GLN 50 50 50 GLN GLN A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 PHE 52 52 52 PHE PHE A . n 
A 1 53 VAL 53 53 53 VAL VAL A . n 
A 1 54 PRO 54 54 54 PRO PRO A . n 
A 1 55 ALA 55 55 55 ALA ALA A . n 
A 1 56 ALA 56 56 56 ALA ALA A . n 
A 1 57 TYR 57 57 57 TYR TYR A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
A 1 59 LYS 59 59 59 LYS LYS A . n 
A 1 60 LYS 60 60 60 LYS LYS A . n 
A 1 61 LEU 61 61 61 LEU LEU A . n 
A 1 62 ASP 62 62 62 ASP ASP A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'The R21A mutant of the alpha-spectrin SH3 domain (R21A Spc-SH3) in its P41-bound form' 
_exptl.entry_id                   2JM9 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JM9 
_struct.title                     'R21A Spc-SH3 bound' 
_struct.pdbx_model_details        'The R21A mutant of the alpha-spectrin SH3 domain (R21A Spc-SH3) in its P41-bound form' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JM9 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            'SH3 domain, p41-bound, STRUCTURAL PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    SPTA2_CHICK 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P07751 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   DETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JM9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 62 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07751 
_struct_ref_seq.db_align_beg                  965 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1025 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       62 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JM9 MET A 1  ? UNP P07751 ?   ?   'cloning artifact'    1  1 
1 2JM9 ALA A 21 ? UNP P07751 ARG 984 'engineered mutation' 21 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 49 ? PRO A 54 ? ARG A 49 PRO A 54 
A 2 TRP A 41 ? VAL A 46 ? TRP A 41 VAL A 46 
A 3 ILE A 30 ? ASN A 35 ? ILE A 30 ASN A 35 
A 4 LEU A 8  ? ALA A 11 ? LEU A 8  ALA A 11 
A 5 VAL A 58 ? LYS A 60 ? VAL A 58 LYS A 60 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 51 ? O GLY A 51 N VAL A 44 ? N VAL A 44 
A 2 3 O LYS A 43 ? O LYS A 43 N LEU A 34 ? N LEU A 34 
A 3 4 O LEU A 31 ? O LEU A 31 N VAL A 9  ? N VAL A 9  
A 4 5 N LEU A 10 ? N LEU A 10 O LYS A 59 ? O LYS A 59 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  O    A VAL 46 ? ? H    A ASP 48 ? ? 1.58 
2  2  HE1  A MET 25 ? ? HG13 A VAL 53 ? ? 1.22 
3  4  HD12 A LEU 33 ? ? HZ2  A LYS 60 ? ? 1.32 
4  4  OE1  A GLU 3  ? ? HZ3  A LYS 6  ? ? 1.55 
5  6  HH   A TYR 15 ? ? OE1  A GLU 22 ? ? 1.60 
6  9  HZ3  A LYS 26 ? ? OD2  A ASP 29 ? ? 1.56 
7  12 H2   A MET 1  ? ? OE2  A GLU 45 ? ? 1.54 
8  13 HG   A SER 19 ? ? OE1  A GLU 22 ? ? 1.57 
9  16 HD23 A LEU 33 ? ? HG   A SER 36 ? ? 1.32 
10 17 HE2  A MET 25 ? ? HG13 A VAL 53 ? ? 1.33 
11 18 OD1  A ASP 14 ? ? HZ2  A LYS 26 ? ? 1.57 
12 18 O    A VAL 46 ? ? H    A ASP 48 ? ? 1.59 
13 20 HH   A TYR 15 ? ? OE1  A GLU 22 ? ? 1.56 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  GLU A 7  ? ? 71.23   108.18  
2  1  ASN A 47 ? ? 58.49   -53.20  
3  1  ASP A 48 ? ? -152.14 -17.27  
4  2  GLU A 3  ? ? -116.22 60.44   
5  2  ASN A 47 ? ? 55.30   -63.26  
6  2  ASP A 48 ? ? -143.57 -11.28  
7  3  ASP A 2  ? ? -160.62 -165.80 
8  3  GLU A 3  ? ? -111.19 66.44   
9  3  LYS A 6  ? ? -179.12 -158.55 
10 3  ASN A 47 ? ? -19.60  -65.65  
11 3  ASP A 48 ? ? -140.83 16.25   
12 4  GLU A 3  ? ? -101.12 -149.78 
13 4  THR A 4  ? ? 59.14   17.01   
14 4  LYS A 6  ? ? -160.20 -159.05 
15 4  ASN A 47 ? ? 68.49   -54.03  
16 4  ASP A 48 ? ? -161.04 -8.41   
17 5  ASP A 2  ? ? -172.59 119.65  
18 5  THR A 4  ? ? -78.78  24.94   
19 5  LYS A 6  ? ? -129.87 -165.31 
20 5  SER A 36 ? ? -140.92 33.28   
21 5  ASN A 47 ? ? 54.05   -63.98  
22 6  THR A 4  ? ? 51.97   84.21   
23 6  ASN A 47 ? ? 61.43   -58.81  
24 6  ASP A 48 ? ? -152.52 -15.74  
25 7  ASP A 2  ? ? 176.32  146.05  
26 7  LYS A 6  ? ? -170.40 -152.47 
27 7  ASN A 47 ? ? 71.09   -52.01  
28 7  ASP A 48 ? ? -165.15 -14.69  
29 8  ASP A 2  ? ? -112.43 50.97   
30 8  THR A 4  ? ? 43.75   26.03   
31 8  LYS A 6  ? ? -146.35 -158.68 
32 8  GLU A 7  ? ? -37.18  112.42  
33 8  ASN A 47 ? ? 62.32   -57.76  
34 8  ASP A 48 ? ? -159.38 -10.88  
35 9  THR A 4  ? ? 47.05   26.29   
36 9  LYS A 6  ? ? -119.99 -156.57 
37 9  ASN A 47 ? ? 58.90   -59.89  
38 9  ASP A 48 ? ? -148.01 -5.53   
39 10 GLU A 3  ? ? -121.07 -156.26 
40 10 LYS A 6  ? ? -127.00 -160.73 
41 10 GLU A 7  ? ? -36.10  127.49  
42 10 ASN A 47 ? ? 54.47   -65.10  
43 11 GLU A 3  ? ? -134.44 -89.64  
44 11 THR A 4  ? ? 42.73   29.53   
45 11 LYS A 6  ? ? -142.34 -158.10 
46 11 ASN A 47 ? ? 68.54   -50.96  
47 11 ASP A 48 ? ? -164.21 -18.59  
48 12 LYS A 6  ? ? 175.74  -144.77 
49 12 ASN A 47 ? ? 59.66   -57.72  
50 12 ASP A 48 ? ? -148.25 -16.69  
51 13 GLU A 3  ? ? -122.20 -168.71 
52 13 GLU A 7  ? ? 58.27   88.80   
53 13 SER A 19 ? ? 178.30  170.61  
54 13 ASN A 47 ? ? 69.59   -53.59  
55 13 ASP A 48 ? ? -161.33 -18.39  
56 14 ASP A 2  ? ? -160.54 87.91   
57 14 GLU A 3  ? ? -118.16 -81.55  
58 14 LYS A 6  ? ? -161.15 -168.04 
59 14 ASN A 47 ? ? 70.83   -50.76  
60 14 ASP A 48 ? ? -174.93 -1.12   
61 15 ASP A 2  ? ? 51.87   -159.28 
62 15 THR A 4  ? ? -165.93 102.69  
63 15 ASN A 47 ? ? 59.86   -57.56  
64 15 ASP A 48 ? ? -153.99 -1.20   
65 16 LYS A 6  ? ? -151.67 -156.52 
66 16 ASN A 47 ? ? 71.81   -53.17  
67 16 ASP A 48 ? ? -165.57 -15.72  
68 17 LYS A 6  ? ? -165.58 -153.26 
69 17 ASN A 47 ? ? 69.52   -50.32  
70 17 ASP A 48 ? ? -164.00 -16.00  
71 18 ASN A 47 ? ? 56.95   -57.65  
72 18 ASP A 48 ? ? -147.35 -11.55  
73 19 GLU A 3  ? ? -116.92 65.30   
74 19 ASN A 47 ? ? 27.89   87.18   
75 19 ASP A 48 ? ? 61.62   -3.49   
76 20 ASP A 2  ? ? -164.89 97.06   
77 20 LYS A 6  ? ? -116.12 -161.79 
78 20 ASN A 47 ? ? 50.63   -75.76  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JM9 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JM9 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.contents         '2 mM R21A Spc-SH3 bound, 5.2 mM P41, 90 % H2O, 10 % D2O, 20 mM d5-glycine' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
'R21A Spc-SH3 bound' 2   mM ? 1 
P41                  5.2 mM ? 1 
H2O                  90  %  ? 1 
D2O                  10  %  ? 1 
d5-glycine           20  mM ? 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  3.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D TOCSY' 
1 2 1 '2D NOESY' 
# 
_pdbx_nmr_refine.details            'Final refinement in explicit solvent within ARIA' 
_pdbx_nmr_refine.entry_id           2JM9 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing           NMRView ? 1 
Johnson                                             'structure solution' NMRView ? 2 
Johnson                                             'data analysis'      NMRView ? 3 
'Herrmann, Guntert and Wuthrich'                    'structure solution' CYANA   ? 4 
;Linge, O'Donoghue and Nilges
;
refinement           ARIA    ? 5 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
ILE N    N N N 123 
ILE CA   C N S 124 
ILE C    C N N 125 
ILE O    O N N 126 
ILE CB   C N S 127 
ILE CG1  C N N 128 
ILE CG2  C N N 129 
ILE CD1  C N N 130 
ILE OXT  O N N 131 
ILE H    H N N 132 
ILE H2   H N N 133 
ILE HA   H N N 134 
ILE HB   H N N 135 
ILE HG12 H N N 136 
ILE HG13 H N N 137 
ILE HG21 H N N 138 
ILE HG22 H N N 139 
ILE HG23 H N N 140 
ILE HD11 H N N 141 
ILE HD12 H N N 142 
ILE HD13 H N N 143 
ILE HXT  H N N 144 
LEU N    N N N 145 
LEU CA   C N S 146 
LEU C    C N N 147 
LEU O    O N N 148 
LEU CB   C N N 149 
LEU CG   C N N 150 
LEU CD1  C N N 151 
LEU CD2  C N N 152 
LEU OXT  O N N 153 
LEU H    H N N 154 
LEU H2   H N N 155 
LEU HA   H N N 156 
LEU HB2  H N N 157 
LEU HB3  H N N 158 
LEU HG   H N N 159 
LEU HD11 H N N 160 
LEU HD12 H N N 161 
LEU HD13 H N N 162 
LEU HD21 H N N 163 
LEU HD22 H N N 164 
LEU HD23 H N N 165 
LEU HXT  H N N 166 
LYS N    N N N 167 
LYS CA   C N S 168 
LYS C    C N N 169 
LYS O    O N N 170 
LYS CB   C N N 171 
LYS CG   C N N 172 
LYS CD   C N N 173 
LYS CE   C N N 174 
LYS NZ   N N N 175 
LYS OXT  O N N 176 
LYS H    H N N 177 
LYS H2   H N N 178 
LYS HA   H N N 179 
LYS HB2  H N N 180 
LYS HB3  H N N 181 
LYS HG2  H N N 182 
LYS HG3  H N N 183 
LYS HD2  H N N 184 
LYS HD3  H N N 185 
LYS HE2  H N N 186 
LYS HE3  H N N 187 
LYS HZ1  H N N 188 
LYS HZ2  H N N 189 
LYS HZ3  H N N 190 
LYS HXT  H N N 191 
MET N    N N N 192 
MET CA   C N S 193 
MET C    C N N 194 
MET O    O N N 195 
MET CB   C N N 196 
MET CG   C N N 197 
MET SD   S N N 198 
MET CE   C N N 199 
MET OXT  O N N 200 
MET H    H N N 201 
MET H2   H N N 202 
MET HA   H N N 203 
MET HB2  H N N 204 
MET HB3  H N N 205 
MET HG2  H N N 206 
MET HG3  H N N 207 
MET HE1  H N N 208 
MET HE2  H N N 209 
MET HE3  H N N 210 
MET HXT  H N N 211 
PHE N    N N N 212 
PHE CA   C N S 213 
PHE C    C N N 214 
PHE O    O N N 215 
PHE CB   C N N 216 
PHE CG   C Y N 217 
PHE CD1  C Y N 218 
PHE CD2  C Y N 219 
PHE CE1  C Y N 220 
PHE CE2  C Y N 221 
PHE CZ   C Y N 222 
PHE OXT  O N N 223 
PHE H    H N N 224 
PHE H2   H N N 225 
PHE HA   H N N 226 
PHE HB2  H N N 227 
PHE HB3  H N N 228 
PHE HD1  H N N 229 
PHE HD2  H N N 230 
PHE HE1  H N N 231 
PHE HE2  H N N 232 
PHE HZ   H N N 233 
PHE HXT  H N N 234 
PRO N    N N N 235 
PRO CA   C N S 236 
PRO C    C N N 237 
PRO O    O N N 238 
PRO CB   C N N 239 
PRO CG   C N N 240 
PRO CD   C N N 241 
PRO OXT  O N N 242 
PRO H    H N N 243 
PRO HA   H N N 244 
PRO HB2  H N N 245 
PRO HB3  H N N 246 
PRO HG2  H N N 247 
PRO HG3  H N N 248 
PRO HD2  H N N 249 
PRO HD3  H N N 250 
PRO HXT  H N N 251 
SER N    N N N 252 
SER CA   C N S 253 
SER C    C N N 254 
SER O    O N N 255 
SER CB   C N N 256 
SER OG   O N N 257 
SER OXT  O N N 258 
SER H    H N N 259 
SER H2   H N N 260 
SER HA   H N N 261 
SER HB2  H N N 262 
SER HB3  H N N 263 
SER HG   H N N 264 
SER HXT  H N N 265 
THR N    N N N 266 
THR CA   C N S 267 
THR C    C N N 268 
THR O    O N N 269 
THR CB   C N R 270 
THR OG1  O N N 271 
THR CG2  C N N 272 
THR OXT  O N N 273 
THR H    H N N 274 
THR H2   H N N 275 
THR HA   H N N 276 
THR HB   H N N 277 
THR HG1  H N N 278 
THR HG21 H N N 279 
THR HG22 H N N 280 
THR HG23 H N N 281 
THR HXT  H N N 282 
TRP N    N N N 283 
TRP CA   C N S 284 
TRP C    C N N 285 
TRP O    O N N 286 
TRP CB   C N N 287 
TRP CG   C Y N 288 
TRP CD1  C Y N 289 
TRP CD2  C Y N 290 
TRP NE1  N Y N 291 
TRP CE2  C Y N 292 
TRP CE3  C Y N 293 
TRP CZ2  C Y N 294 
TRP CZ3  C Y N 295 
TRP CH2  C Y N 296 
TRP OXT  O N N 297 
TRP H    H N N 298 
TRP H2   H N N 299 
TRP HA   H N N 300 
TRP HB2  H N N 301 
TRP HB3  H N N 302 
TRP HD1  H N N 303 
TRP HE1  H N N 304 
TRP HE3  H N N 305 
TRP HZ2  H N N 306 
TRP HZ3  H N N 307 
TRP HH2  H N N 308 
TRP HXT  H N N 309 
TYR N    N N N 310 
TYR CA   C N S 311 
TYR C    C N N 312 
TYR O    O N N 313 
TYR CB   C N N 314 
TYR CG   C Y N 315 
TYR CD1  C Y N 316 
TYR CD2  C Y N 317 
TYR CE1  C Y N 318 
TYR CE2  C Y N 319 
TYR CZ   C Y N 320 
TYR OH   O N N 321 
TYR OXT  O N N 322 
TYR H    H N N 323 
TYR H2   H N N 324 
TYR HA   H N N 325 
TYR HB2  H N N 326 
TYR HB3  H N N 327 
TYR HD1  H N N 328 
TYR HD2  H N N 329 
TYR HE1  H N N 330 
TYR HE2  H N N 331 
TYR HH   H N N 332 
TYR HXT  H N N 333 
VAL N    N N N 334 
VAL CA   C N S 335 
VAL C    C N N 336 
VAL O    O N N 337 
VAL CB   C N N 338 
VAL CG1  C N N 339 
VAL CG2  C N N 340 
VAL OXT  O N N 341 
VAL H    H N N 342 
VAL H2   H N N 343 
VAL HA   H N N 344 
VAL HB   H N N 345 
VAL HG11 H N N 346 
VAL HG12 H N N 347 
VAL HG13 H N N 348 
VAL HG21 H N N 349 
VAL HG22 H N N 350 
VAL HG23 H N N 351 
VAL HXT  H N N 352 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
ILE N   CA   sing N N 116 
ILE N   H    sing N N 117 
ILE N   H2   sing N N 118 
ILE CA  C    sing N N 119 
ILE CA  CB   sing N N 120 
ILE CA  HA   sing N N 121 
ILE C   O    doub N N 122 
ILE C   OXT  sing N N 123 
ILE CB  CG1  sing N N 124 
ILE CB  CG2  sing N N 125 
ILE CB  HB   sing N N 126 
ILE CG1 CD1  sing N N 127 
ILE CG1 HG12 sing N N 128 
ILE CG1 HG13 sing N N 129 
ILE CG2 HG21 sing N N 130 
ILE CG2 HG22 sing N N 131 
ILE CG2 HG23 sing N N 132 
ILE CD1 HD11 sing N N 133 
ILE CD1 HD12 sing N N 134 
ILE CD1 HD13 sing N N 135 
ILE OXT HXT  sing N N 136 
LEU N   CA   sing N N 137 
LEU N   H    sing N N 138 
LEU N   H2   sing N N 139 
LEU CA  C    sing N N 140 
LEU CA  CB   sing N N 141 
LEU CA  HA   sing N N 142 
LEU C   O    doub N N 143 
LEU C   OXT  sing N N 144 
LEU CB  CG   sing N N 145 
LEU CB  HB2  sing N N 146 
LEU CB  HB3  sing N N 147 
LEU CG  CD1  sing N N 148 
LEU CG  CD2  sing N N 149 
LEU CG  HG   sing N N 150 
LEU CD1 HD11 sing N N 151 
LEU CD1 HD12 sing N N 152 
LEU CD1 HD13 sing N N 153 
LEU CD2 HD21 sing N N 154 
LEU CD2 HD22 sing N N 155 
LEU CD2 HD23 sing N N 156 
LEU OXT HXT  sing N N 157 
LYS N   CA   sing N N 158 
LYS N   H    sing N N 159 
LYS N   H2   sing N N 160 
LYS CA  C    sing N N 161 
LYS CA  CB   sing N N 162 
LYS CA  HA   sing N N 163 
LYS C   O    doub N N 164 
LYS C   OXT  sing N N 165 
LYS CB  CG   sing N N 166 
LYS CB  HB2  sing N N 167 
LYS CB  HB3  sing N N 168 
LYS CG  CD   sing N N 169 
LYS CG  HG2  sing N N 170 
LYS CG  HG3  sing N N 171 
LYS CD  CE   sing N N 172 
LYS CD  HD2  sing N N 173 
LYS CD  HD3  sing N N 174 
LYS CE  NZ   sing N N 175 
LYS CE  HE2  sing N N 176 
LYS CE  HE3  sing N N 177 
LYS NZ  HZ1  sing N N 178 
LYS NZ  HZ2  sing N N 179 
LYS NZ  HZ3  sing N N 180 
LYS OXT HXT  sing N N 181 
MET N   CA   sing N N 182 
MET N   H    sing N N 183 
MET N   H2   sing N N 184 
MET CA  C    sing N N 185 
MET CA  CB   sing N N 186 
MET CA  HA   sing N N 187 
MET C   O    doub N N 188 
MET C   OXT  sing N N 189 
MET CB  CG   sing N N 190 
MET CB  HB2  sing N N 191 
MET CB  HB3  sing N N 192 
MET CG  SD   sing N N 193 
MET CG  HG2  sing N N 194 
MET CG  HG3  sing N N 195 
MET SD  CE   sing N N 196 
MET CE  HE1  sing N N 197 
MET CE  HE2  sing N N 198 
MET CE  HE3  sing N N 199 
MET OXT HXT  sing N N 200 
PHE N   CA   sing N N 201 
PHE N   H    sing N N 202 
PHE N   H2   sing N N 203 
PHE CA  C    sing N N 204 
PHE CA  CB   sing N N 205 
PHE CA  HA   sing N N 206 
PHE C   O    doub N N 207 
PHE C   OXT  sing N N 208 
PHE CB  CG   sing N N 209 
PHE CB  HB2  sing N N 210 
PHE CB  HB3  sing N N 211 
PHE CG  CD1  doub Y N 212 
PHE CG  CD2  sing Y N 213 
PHE CD1 CE1  sing Y N 214 
PHE CD1 HD1  sing N N 215 
PHE CD2 CE2  doub Y N 216 
PHE CD2 HD2  sing N N 217 
PHE CE1 CZ   doub Y N 218 
PHE CE1 HE1  sing N N 219 
PHE CE2 CZ   sing Y N 220 
PHE CE2 HE2  sing N N 221 
PHE CZ  HZ   sing N N 222 
PHE OXT HXT  sing N N 223 
PRO N   CA   sing N N 224 
PRO N   CD   sing N N 225 
PRO N   H    sing N N 226 
PRO CA  C    sing N N 227 
PRO CA  CB   sing N N 228 
PRO CA  HA   sing N N 229 
PRO C   O    doub N N 230 
PRO C   OXT  sing N N 231 
PRO CB  CG   sing N N 232 
PRO CB  HB2  sing N N 233 
PRO CB  HB3  sing N N 234 
PRO CG  CD   sing N N 235 
PRO CG  HG2  sing N N 236 
PRO CG  HG3  sing N N 237 
PRO CD  HD2  sing N N 238 
PRO CD  HD3  sing N N 239 
PRO OXT HXT  sing N N 240 
SER N   CA   sing N N 241 
SER N   H    sing N N 242 
SER N   H2   sing N N 243 
SER CA  C    sing N N 244 
SER CA  CB   sing N N 245 
SER CA  HA   sing N N 246 
SER C   O    doub N N 247 
SER C   OXT  sing N N 248 
SER CB  OG   sing N N 249 
SER CB  HB2  sing N N 250 
SER CB  HB3  sing N N 251 
SER OG  HG   sing N N 252 
SER OXT HXT  sing N N 253 
THR N   CA   sing N N 254 
THR N   H    sing N N 255 
THR N   H2   sing N N 256 
THR CA  C    sing N N 257 
THR CA  CB   sing N N 258 
THR CA  HA   sing N N 259 
THR C   O    doub N N 260 
THR C   OXT  sing N N 261 
THR CB  OG1  sing N N 262 
THR CB  CG2  sing N N 263 
THR CB  HB   sing N N 264 
THR OG1 HG1  sing N N 265 
THR CG2 HG21 sing N N 266 
THR CG2 HG22 sing N N 267 
THR CG2 HG23 sing N N 268 
THR OXT HXT  sing N N 269 
TRP N   CA   sing N N 270 
TRP N   H    sing N N 271 
TRP N   H2   sing N N 272 
TRP CA  C    sing N N 273 
TRP CA  CB   sing N N 274 
TRP CA  HA   sing N N 275 
TRP C   O    doub N N 276 
TRP C   OXT  sing N N 277 
TRP CB  CG   sing N N 278 
TRP CB  HB2  sing N N 279 
TRP CB  HB3  sing N N 280 
TRP CG  CD1  doub Y N 281 
TRP CG  CD2  sing Y N 282 
TRP CD1 NE1  sing Y N 283 
TRP CD1 HD1  sing N N 284 
TRP CD2 CE2  doub Y N 285 
TRP CD2 CE3  sing Y N 286 
TRP NE1 CE2  sing Y N 287 
TRP NE1 HE1  sing N N 288 
TRP CE2 CZ2  sing Y N 289 
TRP CE3 CZ3  doub Y N 290 
TRP CE3 HE3  sing N N 291 
TRP CZ2 CH2  doub Y N 292 
TRP CZ2 HZ2  sing N N 293 
TRP CZ3 CH2  sing Y N 294 
TRP CZ3 HZ3  sing N N 295 
TRP CH2 HH2  sing N N 296 
TRP OXT HXT  sing N N 297 
TYR N   CA   sing N N 298 
TYR N   H    sing N N 299 
TYR N   H2   sing N N 300 
TYR CA  C    sing N N 301 
TYR CA  CB   sing N N 302 
TYR CA  HA   sing N N 303 
TYR C   O    doub N N 304 
TYR C   OXT  sing N N 305 
TYR CB  CG   sing N N 306 
TYR CB  HB2  sing N N 307 
TYR CB  HB3  sing N N 308 
TYR CG  CD1  doub Y N 309 
TYR CG  CD2  sing Y N 310 
TYR CD1 CE1  sing Y N 311 
TYR CD1 HD1  sing N N 312 
TYR CD2 CE2  doub Y N 313 
TYR CD2 HD2  sing N N 314 
TYR CE1 CZ   doub Y N 315 
TYR CE1 HE1  sing N N 316 
TYR CE2 CZ   sing Y N 317 
TYR CE2 HE2  sing N N 318 
TYR CZ  OH   sing N N 319 
TYR OH  HH   sing N N 320 
TYR OXT HXT  sing N N 321 
VAL N   CA   sing N N 322 
VAL N   H    sing N N 323 
VAL N   H2   sing N N 324 
VAL CA  C    sing N N 325 
VAL CA  CB   sing N N 326 
VAL CA  HA   sing N N 327 
VAL C   O    doub N N 328 
VAL C   OXT  sing N N 329 
VAL CB  CG1  sing N N 330 
VAL CB  CG2  sing N N 331 
VAL CB  HB   sing N N 332 
VAL CG1 HG11 sing N N 333 
VAL CG1 HG12 sing N N 334 
VAL CG1 HG13 sing N N 335 
VAL CG2 HG21 sing N N 336 
VAL CG2 HG22 sing N N 337 
VAL CG2 HG23 sing N N 338 
VAL OXT HXT  sing N N 339 
# 
_pdbx_nmr_spectrometer.field_strength    750 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DRX' 
# 
_atom_sites.entry_id                    2JM9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_