data_2JMK # _entry.id 2JMK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2JMK RCSB RCSB100020 WWPDB D_1000100020 BMRB 15039 # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15039 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JMK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-11-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Koo, B.' 1 'Jung, J.' 2 'Jung, H.' 3 'Nam, H.' 4 'Kim, Y.' 5 'Yee, A.' 6 'Arrowsmith, C.H.' 7 'Lee, W.' 8 # _citation.id primary _citation.title 'Solution structure of the hypothetical novel-fold protein TA0956 from Thermoplasma acidophilum' _citation.journal_abbrev Proteins _citation.journal_volume 69 _citation.page_first 444 _citation.page_last 447 _citation.year 2007 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17634985 _citation.pdbx_database_id_DOI 10.1002/prot.21490 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koo, B.K.' 1 ? primary 'Jung, J.' 2 ? primary 'Jung, H.' 3 ? primary 'Nam, H.W.' 4 ? primary 'Kim, Y.S.' 5 ? primary 'Yee, A.' 6 ? primary 'Lee, W.' 7 ? # _cell.entry_id 2JMK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JMK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein Ta0956' _entity.formula_weight 12629.563 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMTLCAMYNISMAGSHPTTICVVMDRFLESFSELYDIIDENDTDVMMDFISRFARTDEIMPEDKTVGFVVVNADKKLMSV SFSDIDENMKKVIKATAEKFKNKGFKVETDM ; _entity_poly.pdbx_seq_one_letter_code_can ;GMTLCAMYNISMAGSHPTTICVVMDRFLESFSELYDIIDENDTDVMMDFISRFARTDEIMPEDKTVGFVVVNADKKLMSV SFSDIDENMKKVIKATAEKFKNKGFKVETDM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 THR n 1 4 LEU n 1 5 CYS n 1 6 ALA n 1 7 MET n 1 8 TYR n 1 9 ASN n 1 10 ILE n 1 11 SER n 1 12 MET n 1 13 ALA n 1 14 GLY n 1 15 SER n 1 16 HIS n 1 17 PRO n 1 18 THR n 1 19 THR n 1 20 ILE n 1 21 CYS n 1 22 VAL n 1 23 VAL n 1 24 MET n 1 25 ASP n 1 26 ARG n 1 27 PHE n 1 28 LEU n 1 29 GLU n 1 30 SER n 1 31 PHE n 1 32 SER n 1 33 GLU n 1 34 LEU n 1 35 TYR n 1 36 ASP n 1 37 ILE n 1 38 ILE n 1 39 ASP n 1 40 GLU n 1 41 ASN n 1 42 ASP n 1 43 THR n 1 44 ASP n 1 45 VAL n 1 46 MET n 1 47 MET n 1 48 ASP n 1 49 PHE n 1 50 ILE n 1 51 SER n 1 52 ARG n 1 53 PHE n 1 54 ALA n 1 55 ARG n 1 56 THR n 1 57 ASP n 1 58 GLU n 1 59 ILE n 1 60 MET n 1 61 PRO n 1 62 GLU n 1 63 ASP n 1 64 LYS n 1 65 THR n 1 66 VAL n 1 67 GLY n 1 68 PHE n 1 69 VAL n 1 70 VAL n 1 71 VAL n 1 72 ASN n 1 73 ALA n 1 74 ASP n 1 75 LYS n 1 76 LYS n 1 77 LEU n 1 78 MET n 1 79 SER n 1 80 VAL n 1 81 SER n 1 82 PHE n 1 83 SER n 1 84 ASP n 1 85 ILE n 1 86 ASP n 1 87 GLU n 1 88 ASN n 1 89 MET n 1 90 LYS n 1 91 LYS n 1 92 VAL n 1 93 ILE n 1 94 LYS n 1 95 ALA n 1 96 THR n 1 97 ALA n 1 98 GLU n 1 99 LYS n 1 100 PHE n 1 101 LYS n 1 102 ASN n 1 103 LYS n 1 104 GLY n 1 105 PHE n 1 106 LYS n 1 107 VAL n 1 108 GLU n 1 109 THR n 1 110 ASP n 1 111 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermoplasma _entity_src_gen.pdbx_gene_src_gene ta0956 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9HJL1_THEAC _struct_ref.pdbx_db_accession Q9HJL1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTLCAMYNISMAGSHPTTICVVMDRFLESFSELYDIIDENDTDVMMDFISRFARTDEIMPEDKTVGFVVVNADKKLMSVS FSDIDENMKKVIKATAEKFKNKGFKVETDM ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JMK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HJL1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2JMK _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9HJL1 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '2D 1H-15N HSQC' 1 3 2 '2D 1H-13C HSQC' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D HNCO' 1 7 1 '3D HNCA' 1 8 2 '3D HCCH-TOCSY' 1 9 2 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 373.15 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure Ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.5 mM [U-98% 13C; U-98% 15N] ta0956, 20 mM sodium phosphate, 100 mM sodium chloride, 5 mM DTT, 0.01 w/v sodium azide, 0.01 w/v DSS, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1.5 mM [U-98% 13C; U-98% 15N] ta0956, 20 mM sodium phosphate, 100 mM sodium chloride, 5 mM DTT, 0.01 w/v sodium azide, 0.01 w/v DSS, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker DRX 1 'Bruker DRX' 800 Bruker AMX 2 'Bruker AMX' # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 2JMK _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JMK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JMK _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal GUNTERT refinement CYANA 2.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing CYANA ? 2 'Bruker Biospin' collection XwinNMR ? 3 Goddard 'structure solution' Sparky ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JMK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JMK _struct.title 'Solution structure of ta0956' _struct.pdbx_descriptor 'Hypothetical protein Ta0956' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JMK _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Hypothetical Protein, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 26 ? ILE A 38 ? ARG A 25 ILE A 37 1 ? 13 HELX_P HELX_P2 2 ASP A 44 ? ALA A 54 ? ASP A 43 ALA A 53 1 ? 11 HELX_P HELX_P3 3 ASN A 88 ? PHE A 100 ? ASN A 87 PHE A 99 1 ? 13 HELX_P HELX_P4 4 LYS A 101 ? GLY A 104 ? LYS A 100 GLY A 103 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 18 ? VAL A 23 ? THR A 17 VAL A 22 A 2 LEU A 4 ? SER A 11 ? LEU A 3 SER A 10 A 3 LYS A 64 ? ASN A 72 ? LYS A 63 ASN A 71 A 4 LEU A 77 ? PHE A 82 ? LEU A 76 PHE A 81 A 5 LYS A 106 ? THR A 109 ? LYS A 105 THR A 108 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 20 ? O ILE A 19 N TYR A 8 ? N TYR A 7 A 2 3 N CYS A 5 ? N CYS A 4 O LYS A 64 ? O LYS A 63 A 3 4 N PHE A 68 ? N PHE A 67 O SER A 81 ? O SER A 80 A 4 5 N VAL A 80 ? N VAL A 79 O GLU A 108 ? O GLU A 107 # _atom_sites.entry_id 2JMK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 CYS 5 4 4 CYS CYS A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 MET 7 6 6 MET MET A . n A 1 8 TYR 8 7 7 TYR TYR A . n A 1 9 ASN 9 8 8 ASN ASN A . n A 1 10 ILE 10 9 9 ILE ILE A . n A 1 11 SER 11 10 10 SER SER A . n A 1 12 MET 12 11 11 MET MET A . n A 1 13 ALA 13 12 12 ALA ALA A . n A 1 14 GLY 14 13 13 GLY GLY A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 HIS 16 15 15 HIS HIS A . n A 1 17 PRO 17 16 16 PRO PRO A . n A 1 18 THR 18 17 17 THR THR A . n A 1 19 THR 19 18 18 THR THR A . n A 1 20 ILE 20 19 19 ILE ILE A . n A 1 21 CYS 21 20 20 CYS CYS A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 MET 24 23 23 MET MET A . n A 1 25 ASP 25 24 24 ASP ASP A . n A 1 26 ARG 26 25 25 ARG ARG A . n A 1 27 PHE 27 26 26 PHE PHE A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 GLU 29 28 28 GLU GLU A . n A 1 30 SER 30 29 29 SER SER A . n A 1 31 PHE 31 30 30 PHE PHE A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 LEU 34 33 33 LEU LEU A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 ASP 36 35 35 ASP ASP A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 ILE 38 37 37 ILE ILE A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 ASN 41 40 40 ASN ASN A . n A 1 42 ASP 42 41 41 ASP ASP A . n A 1 43 THR 43 42 42 THR THR A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 MET 46 45 45 MET MET A . n A 1 47 MET 47 46 46 MET MET A . n A 1 48 ASP 48 47 47 ASP ASP A . n A 1 49 PHE 49 48 48 PHE PHE A . n A 1 50 ILE 50 49 49 ILE ILE A . n A 1 51 SER 51 50 50 SER SER A . n A 1 52 ARG 52 51 51 ARG ARG A . n A 1 53 PHE 53 52 52 PHE PHE A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 ARG 55 54 54 ARG ARG A . n A 1 56 THR 56 55 55 THR THR A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 ILE 59 58 58 ILE ILE A . n A 1 60 MET 60 59 59 MET MET A . n A 1 61 PRO 61 60 60 PRO PRO A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 ASP 63 62 62 ASP ASP A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 THR 65 64 64 THR THR A . n A 1 66 VAL 66 65 65 VAL VAL A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 PHE 68 67 67 PHE PHE A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 VAL 71 70 70 VAL VAL A . n A 1 72 ASN 72 71 71 ASN ASN A . n A 1 73 ALA 73 72 72 ALA ALA A . n A 1 74 ASP 74 73 73 ASP ASP A . n A 1 75 LYS 75 74 74 LYS LYS A . n A 1 76 LYS 76 75 75 LYS LYS A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 MET 78 77 77 MET MET A . n A 1 79 SER 79 78 78 SER SER A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 SER 81 80 80 SER SER A . n A 1 82 PHE 82 81 81 PHE PHE A . n A 1 83 SER 83 82 82 SER SER A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 ASP 86 85 85 ASP ASP A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 ASN 88 87 87 ASN ASN A . n A 1 89 MET 89 88 88 MET MET A . n A 1 90 LYS 90 89 89 LYS LYS A . n A 1 91 LYS 91 90 90 LYS LYS A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 ILE 93 92 92 ILE ILE A . n A 1 94 LYS 94 93 93 LYS LYS A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 THR 96 95 95 THR THR A . n A 1 97 ALA 97 96 96 ALA ALA A . n A 1 98 GLU 98 97 97 GLU GLU A . n A 1 99 LYS 99 98 98 LYS LYS A . n A 1 100 PHE 100 99 99 PHE PHE A . n A 1 101 LYS 101 100 100 LYS LYS A . n A 1 102 ASN 102 101 101 ASN ASN A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 GLY 104 103 103 GLY GLY A . n A 1 105 PHE 105 104 104 PHE PHE A . n A 1 106 LYS 106 105 105 LYS LYS A . n A 1 107 VAL 107 106 106 VAL VAL A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 THR 109 108 108 THR THR A . n A 1 110 ASP 110 109 109 ASP ASP A . n A 1 111 MET 111 110 110 MET MET A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_sample_details 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ta0956 1.5 mM '[U-98% 13C; U-98% 15N]' 1 'sodium phosphate' 20 mM ? 1 'sodium chloride' 100 mM ? 1 DTT 5 mM ? 1 'sodium azide' 0.01 w/v ? 1 DSS 0.01 w/v ? 1 ta0956 1.5 mM '[U-98% 13C; U-98% 15N]' 2 'sodium phosphate' 20 mM ? 2 'sodium chloride' 100 mM ? 2 DTT 5 mM ? 2 'sodium azide' 0.01 w/v ? 2 DSS 0.01 w/v ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 11 ? ? -54.36 173.62 2 1 ALA A 12 ? ? -54.11 101.44 3 1 HIS A 15 ? ? 62.52 160.66 4 1 SER A 82 ? ? -125.19 -169.97 5 1 LYS A 105 ? ? -64.18 92.70 6 2 ASP A 56 ? ? -98.53 -65.31 7 3 ALA A 53 ? ? -66.57 98.25 8 3 ASP A 83 ? ? -65.73 91.69 9 4 ALA A 12 ? ? -51.67 109.86 10 4 ASP A 56 ? ? -102.53 -66.98 11 5 ASN A 40 ? ? -104.63 50.44 12 5 ASP A 83 ? ? -53.78 106.75 13 6 SER A 14 ? ? -126.96 -79.13 14 6 HIS A 15 ? ? 177.22 156.32 15 6 ASN A 40 ? ? -102.81 48.66 16 6 MET A 59 ? ? -118.60 71.53 17 6 GLU A 61 ? ? -150.54 19.31 18 6 ASP A 83 ? ? 61.49 63.19 19 7 ASP A 56 ? ? -119.29 -169.26 20 7 GLU A 57 ? ? -67.29 88.22 21 8 ALA A 12 ? ? -51.61 108.43 22 8 GLU A 57 ? ? -94.08 40.29 23 8 ASP A 83 ? ? 63.32 79.03 24 8 LYS A 105 ? ? -68.77 86.23 25 9 ASN A 40 ? ? -92.32 52.00 26 9 GLU A 57 ? ? 60.48 73.09 27 9 LYS A 75 ? ? 39.75 54.84 28 9 SER A 82 ? ? -73.73 -169.41 29 9 ASP A 83 ? ? -51.55 103.43 30 10 MET A 11 ? ? -54.53 173.98 31 10 MET A 59 ? ? -161.53 66.94 32 10 LYS A 75 ? ? 38.60 55.23 33 10 ASP A 83 ? ? 63.34 61.71 34 11 ASP A 41 ? ? -51.05 103.68 35 11 GLU A 57 ? ? -51.29 109.48 36 11 MET A 59 ? ? -115.15 70.75 37 11 GLU A 61 ? ? -154.76 21.56 38 11 SER A 82 ? ? -54.93 170.58 39 11 ASP A 83 ? ? -55.00 107.70 40 12 ALA A 12 ? ? -51.63 107.73 41 12 THR A 55 ? ? -135.68 -62.74 42 12 ASP A 83 ? ? 62.83 86.02 43 13 ALA A 12 ? ? -54.09 101.66 44 13 HIS A 15 ? ? 63.03 160.42 45 13 GLU A 61 ? ? -96.02 32.60 46 13 LYS A 75 ? ? 38.71 47.97 47 14 MET A 59 ? ? -162.84 67.03 48 14 ASP A 83 ? ? 62.32 64.46 49 15 MET A 11 ? ? -53.15 171.85 50 15 SER A 14 ? ? -141.66 17.47 51 15 HIS A 15 ? ? 62.81 160.72 52 15 LYS A 75 ? ? 37.82 44.18 53 15 ASP A 83 ? ? -68.52 89.05 54 16 ASN A 40 ? ? -108.10 46.35 55 17 ALA A 12 ? ? -51.15 103.45 56 17 HIS A 15 ? ? 62.38 160.81 57 17 ASP A 83 ? ? -52.70 107.08 58 18 MET A 11 ? ? -56.78 174.96 59 18 ALA A 12 ? ? -52.87 102.67 60 18 HIS A 15 ? ? 62.44 160.75 61 18 ASP A 38 ? ? -95.69 31.75 62 18 GLU A 57 ? ? -99.75 38.49 63 18 MET A 59 ? ? -179.37 -61.11 64 18 ASP A 62 ? ? -56.33 176.84 65 18 LYS A 75 ? ? 61.37 60.15 66 18 ASP A 83 ? ? 62.71 60.96 67 19 SER A 14 ? ? -94.77 38.79 68 19 HIS A 15 ? ? 64.48 153.65 69 19 PRO A 16 ? ? -69.69 98.15 70 19 ASP A 41 ? ? -66.17 99.08 71 19 GLU A 61 ? ? -96.10 34.86 72 19 ASP A 83 ? ? -66.68 90.24 73 20 ALA A 12 ? ? -52.02 106.13 74 20 GLU A 39 ? ? 69.73 81.11 75 20 ASP A 41 ? ? -46.17 155.13 76 20 ASP A 83 ? ? -55.86 107.12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 2 Y 1 A GLY 0 ? A GLY 1 3 3 Y 1 A GLY 0 ? A GLY 1 4 4 Y 1 A GLY 0 ? A GLY 1 5 5 Y 1 A GLY 0 ? A GLY 1 6 6 Y 1 A GLY 0 ? A GLY 1 7 7 Y 1 A GLY 0 ? A GLY 1 8 8 Y 1 A GLY 0 ? A GLY 1 9 9 Y 1 A GLY 0 ? A GLY 1 10 10 Y 1 A GLY 0 ? A GLY 1 11 11 Y 1 A GLY 0 ? A GLY 1 12 12 Y 1 A GLY 0 ? A GLY 1 13 13 Y 1 A GLY 0 ? A GLY 1 14 14 Y 1 A GLY 0 ? A GLY 1 15 15 Y 1 A GLY 0 ? A GLY 1 16 16 Y 1 A GLY 0 ? A GLY 1 17 17 Y 1 A GLY 0 ? A GLY 1 18 18 Y 1 A GLY 0 ? A GLY 1 19 19 Y 1 A GLY 0 ? A GLY 1 20 20 Y 1 A GLY 0 ? A GLY 1 #