data_2JN6 # _entry.id 2JN6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2JN6 RCSB RCSB100042 WWPDB D_1000100042 BMRB 15086 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB CgR3 . unspecified BMRB 15086 . unspecified # _pdbx_database_status.deposit_site ? _pdbx_database_status.entry_id 2JN6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-12-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Singarapu, K.K.' 1 'Sukumaran, D.K.' 2 'Parish, D.' 3 'Chen, C.X.' 4 'Cunningham, K.' 5 'Xiao, R.' 6 'Swapna, G.V.T.' 7 'Montelione, G.T.' 8 'Szyperski, T.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title ;NMR structure of protein Cgl2762 from Corynebacterium glutamicum implicated in DNA transposition reveals a helix-turn-helix motif attached to a flexibly disordered leucine zipper. ; _citation.journal_abbrev Proteins _citation.journal_volume 70 _citation.page_first 1650 _citation.page_last 1654 _citation.year 2008 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18175328 _citation.pdbx_database_id_DOI 10.1002/prot.21840 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Singarapu, K.K.' 1 ? primary 'Xiao, R.' 2 ? primary 'Sukumaran, D.K.' 3 ? primary 'Acton, T.' 4 ? primary 'Montelione, G.T.' 5 ? primary 'Szyperski, T.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein Cgl2762' _entity.formula_weight 11045.252 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Transposase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPTKTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSAAVSEAEQIRQLKKENALQRA RTRHPAESCLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MPTKTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSAAVSEAEQIRQLKKENALQRA RTRHPAESCLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CgR3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 THR n 1 4 LYS n 1 5 THR n 1 6 TYR n 1 7 SER n 1 8 GLU n 1 9 GLU n 1 10 PHE n 1 11 LYS n 1 12 ARG n 1 13 ASP n 1 14 ALA n 1 15 VAL n 1 16 ALA n 1 17 LEU n 1 18 TYR n 1 19 GLU n 1 20 ASN n 1 21 SER n 1 22 ASP n 1 23 GLY n 1 24 ALA n 1 25 SER n 1 26 LEU n 1 27 GLN n 1 28 GLN n 1 29 ILE n 1 30 ALA n 1 31 ASN n 1 32 ASP n 1 33 LEU n 1 34 GLY n 1 35 ILE n 1 36 ASN n 1 37 ARG n 1 38 VAL n 1 39 THR n 1 40 LEU n 1 41 LYS n 1 42 ASN n 1 43 TRP n 1 44 ILE n 1 45 ILE n 1 46 LYS n 1 47 TYR n 1 48 GLY n 1 49 SER n 1 50 ASN n 1 51 HIS n 1 52 ASN n 1 53 VAL n 1 54 GLN n 1 55 GLY n 1 56 THR n 1 57 THR n 1 58 PRO n 1 59 SER n 1 60 ALA n 1 61 ALA n 1 62 VAL n 1 63 SER n 1 64 GLU n 1 65 ALA n 1 66 GLU n 1 67 GLN n 1 68 ILE n 1 69 ARG n 1 70 GLN n 1 71 LEU n 1 72 LYS n 1 73 LYS n 1 74 GLU n 1 75 ASN n 1 76 ALA n 1 77 LEU n 1 78 GLN n 1 79 ARG n 1 80 ALA n 1 81 ARG n 1 82 THR n 1 83 ARG n 1 84 HIS n 1 85 PRO n 1 86 ALA n 1 87 GLU n 1 88 SER n 1 89 CYS n 1 90 LEU n 1 91 GLU n 1 92 HIS n 1 93 HIS n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Corynebacterium _entity_src_gen.pdbx_gene_src_gene 'tnp8a ISCg8a' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain XL10 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Corynebacterium glutamicum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1718 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8NM20_CORGL _struct_ref.pdbx_db_accession Q8NM20 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPTKTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSAAVSEAEQIRQLKKENALQRA RTRHPAESC ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JN6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8NM20 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JN6 LEU A 90 ? UNP Q8NM20 ? ? 'cloning artifact' 90 1 1 2JN6 GLU A 91 ? UNP Q8NM20 ? ? 'cloning artifact' 91 2 1 2JN6 HIS A 92 ? UNP Q8NM20 ? ? 'expression tag' 92 3 1 2JN6 HIS A 93 ? UNP Q8NM20 ? ? 'expression tag' 93 4 1 2JN6 HIS A 94 ? UNP Q8NM20 ? ? 'expression tag' 94 5 1 2JN6 HIS A 95 ? UNP Q8NM20 ? ? 'expression tag' 95 6 1 2JN6 HIS A 96 ? UNP Q8NM20 ? ? 'expression tag' 96 7 1 2JN6 HIS A 97 ? UNP Q8NM20 ? ? 'expression tag' 97 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '4,3D GFT HNNCABCA' 1 4 1 '4,3D GFT CABCACONNH' 1 5 1 '4,3D GFT HABCABCONNH' 1 6 1 '4,3D HCCH COSY' 1 7 1 '3D HCCH-COSY' 1 8 1 '3D 13C,15N simultaneous NOESY' 1 9 1 '3D HNCO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.2 mM [U-100% 13C; U-100% 15N] hypothetical protein Cgl2762, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 750 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 2JN6 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JN6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JN6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 1 'Guntert, Braun and Wuthrich' 'data analysis' DYANA 1.5 2 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 3 'Huang, Swapana, Rajan, Ke, Xia, Shukla, Inouye and Montelione' 'data analysis' AutoStructure 2.0 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 5 Varian collection VNMR ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JN6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JN6 _struct.title 'Solution NMR structure of Protein Cgl2762 from Corynebacterium Glutamicum: Northeast Structural Genomics Consortium Target CgR3' _struct.pdbx_descriptor 'Hypothetical protein Cgl2762' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JN6 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;GFT NMR, PSI-2, Protein structure, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 7 ? GLU A 19 ? SER A 7 GLU A 19 1 ? 13 HELX_P HELX_P2 2 ASN A 20 ? ALA A 24 ? ASN A 20 ALA A 24 5 ? 5 HELX_P HELX_P3 3 SER A 25 ? GLY A 34 ? SER A 25 GLY A 34 1 ? 10 HELX_P HELX_P4 4 ASN A 36 ? GLY A 48 ? ASN A 36 GLY A 48 1 ? 13 HELX_P HELX_P5 5 SER A 59 ? GLU A 64 ? SER A 59 GLU A 64 1 ? 6 HELX_P HELX_P6 6 GLU A 64 ? GLU A 74 ? GLU A 64 GLU A 74 1 ? 11 HELX_P HELX_P7 7 ASN A 75 ? ARG A 81 ? ASN A 75 ARG A 81 5 ? 7 HELX_P HELX_P8 8 ALA A 86 ? GLU A 91 ? ALA A 86 GLU A 91 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2JN6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 97 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-02-27 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Experimental preparation' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_sample_details 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_sample_details.contents' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component 'hypothetical protein Cgl2762' _pdbx_nmr_exptl_sample.concentration 1.2 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 46 ? ? OE2 A GLU 64 ? ? 1.56 2 13 OE2 A GLU 8 ? ? HZ2 A LYS 11 ? ? 1.57 3 17 OD1 A ASP 32 ? ? HH12 A ARG 79 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 51 ? ? -178.17 -171.68 2 1 ASN A 52 ? ? -86.51 42.16 3 1 GLN A 54 ? ? -175.30 -165.20 4 1 PRO A 58 ? ? -66.20 85.32 5 1 LYS A 73 ? ? -88.25 -75.60 6 2 ASN A 20 ? ? -95.41 38.87 7 2 ASN A 50 ? ? 74.66 -65.46 8 2 ASN A 52 ? ? -177.07 109.92 9 2 THR A 56 ? ? 48.88 93.84 10 2 LYS A 73 ? ? 66.77 174.02 11 2 THR A 82 ? ? -97.26 -81.66 12 2 PRO A 85 ? ? -57.95 174.87 13 2 HIS A 92 ? ? 62.11 -172.54 14 2 HIS A 94 ? ? 52.52 93.83 15 3 ASN A 50 ? ? 63.52 -72.85 16 3 HIS A 51 ? ? 64.96 -82.90 17 3 GLN A 54 ? ? 54.89 -167.36 18 3 LYS A 73 ? ? 58.02 -104.57 19 3 THR A 82 ? ? -93.42 -82.59 20 3 HIS A 84 ? ? 64.34 102.14 21 3 PRO A 85 ? ? -79.95 -164.83 22 4 THR A 5 ? ? -97.57 -138.64 23 4 ASN A 20 ? ? -82.38 38.00 24 4 HIS A 51 ? ? -156.75 -36.86 25 4 ASN A 52 ? ? -156.27 78.59 26 4 THR A 56 ? ? 49.81 93.15 27 4 HIS A 92 ? ? 48.96 24.24 28 4 HIS A 93 ? ? 64.85 94.82 29 4 HIS A 96 ? ? 74.54 97.48 30 5 LYS A 4 ? ? -156.85 84.88 31 5 ASN A 50 ? ? 77.07 -34.12 32 5 THR A 56 ? ? 53.24 102.21 33 6 PRO A 2 ? ? -87.62 45.00 34 6 THR A 56 ? ? 73.08 115.45 35 6 THR A 82 ? ? -105.34 -82.66 36 6 HIS A 92 ? ? 66.67 169.61 37 6 HIS A 95 ? ? 74.28 104.66 38 7 ALA A 24 ? ? -164.55 119.70 39 7 ASN A 50 ? ? 60.80 -98.15 40 7 HIS A 51 ? ? -154.01 85.14 41 7 ASN A 52 ? ? -100.21 56.27 42 7 THR A 56 ? ? 51.24 93.76 43 7 ARG A 83 ? ? 67.00 140.85 44 7 HIS A 92 ? ? 60.20 -175.37 45 7 HIS A 93 ? ? 59.89 88.92 46 7 HIS A 94 ? ? -144.60 -70.12 47 7 HIS A 95 ? ? 68.43 133.48 48 8 THR A 3 ? ? 67.38 144.54 49 8 ASN A 50 ? ? 73.68 -60.03 50 8 HIS A 96 ? ? 57.55 -97.25 51 9 LYS A 4 ? ? 66.88 114.80 52 9 THR A 5 ? ? -89.44 -154.62 53 9 SER A 7 ? ? -100.19 -169.44 54 9 ASN A 20 ? ? -92.98 38.17 55 9 ASN A 50 ? ? -176.67 -68.43 56 9 GLN A 54 ? ? 61.52 79.32 57 9 PRO A 58 ? ? -63.97 74.30 58 9 ASN A 75 ? ? 50.40 -153.07 59 9 HIS A 93 ? ? -93.53 -92.09 60 9 HIS A 94 ? ? 63.19 114.83 61 10 ALA A 24 ? ? -168.16 95.05 62 10 ASN A 52 ? ? 65.95 100.56 63 10 GLN A 54 ? ? 58.37 71.04 64 10 THR A 56 ? ? 68.14 107.78 65 10 ASN A 75 ? ? 74.17 -29.21 66 10 ARG A 83 ? ? 66.20 130.29 67 11 LYS A 4 ? ? 65.00 88.51 68 11 ASN A 50 ? ? 163.32 -69.88 69 11 ARG A 83 ? ? 59.63 109.95 70 12 THR A 3 ? ? -174.01 -177.02 71 12 ASN A 50 ? ? 77.35 -75.98 72 12 GLN A 54 ? ? -109.92 56.12 73 12 THR A 56 ? ? 50.23 93.99 74 12 LYS A 73 ? ? 58.06 -95.04 75 12 PRO A 85 ? ? -52.09 173.05 76 13 ASN A 50 ? ? -145.59 -50.71 77 13 HIS A 51 ? ? -167.00 -26.91 78 13 ASN A 52 ? ? 63.00 96.24 79 13 THR A 56 ? ? 73.57 110.05 80 13 LYS A 73 ? ? 70.68 91.49 81 13 ASN A 75 ? ? -173.63 -33.66 82 13 PRO A 85 ? ? -56.81 173.13 83 13 HIS A 94 ? ? 65.06 -168.86 84 14 ASN A 50 ? ? 72.34 -49.69 85 14 GLN A 54 ? ? 61.49 82.90 86 14 THR A 56 ? ? 46.74 92.63 87 14 GLU A 74 ? ? 66.37 114.00 88 14 HIS A 92 ? ? 67.92 -174.43 89 14 HIS A 94 ? ? 72.61 139.71 90 15 LYS A 4 ? ? -170.50 102.41 91 15 ASN A 50 ? ? 68.49 -81.84 92 15 THR A 82 ? ? -72.27 -82.99 93 15 HIS A 92 ? ? -100.85 68.22 94 16 HIS A 51 ? ? 59.44 103.13 95 16 THR A 56 ? ? 49.02 93.99 96 16 GLU A 74 ? ? 63.99 -172.45 97 16 PRO A 85 ? ? -86.02 -156.71 98 16 ALA A 86 ? ? 63.03 94.75 99 16 HIS A 92 ? ? -109.40 61.44 100 16 HIS A 94 ? ? 79.24 -178.43 101 17 LYS A 4 ? ? 56.75 77.89 102 17 ALA A 24 ? ? -160.56 118.36 103 17 ASN A 52 ? ? -172.25 122.30 104 17 GLN A 54 ? ? 53.11 94.48 105 17 LYS A 73 ? ? 61.27 87.76 106 17 THR A 82 ? ? -56.60 -82.77 107 17 HIS A 92 ? ? 69.51 129.13 108 18 GLN A 54 ? ? 60.80 -142.75 109 18 THR A 56 ? ? 44.99 94.36 110 18 LYS A 73 ? ? 74.56 125.85 111 18 THR A 82 ? ? -58.81 -79.31 112 18 PRO A 85 ? ? -75.25 -161.05 113 18 HIS A 96 ? ? 59.21 71.90 114 19 ASN A 50 ? ? 64.12 -86.42 115 19 HIS A 51 ? ? -151.28 89.63 116 19 THR A 56 ? ? 44.52 96.63 117 19 GLU A 74 ? ? -89.54 -72.90 118 19 HIS A 93 ? ? -120.62 -169.51 119 19 HIS A 95 ? ? -58.02 -77.55 120 19 HIS A 96 ? ? 60.38 175.77 121 20 THR A 3 ? ? 54.19 103.41 122 20 LYS A 73 ? ? 71.88 129.96 123 20 GLU A 74 ? ? 65.13 -79.79 124 20 ASN A 75 ? ? 59.14 -157.80 125 20 HIS A 92 ? ? 71.71 97.07 #