data_2JNB # _entry.id 2JNB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JNB pdb_00002jnb 10.2210/pdb2jnb/pdb RCSB RCSB100047 ? ? WWPDB D_1000100047 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-12-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JNB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-01-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_id 7249 _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Entry containing chemical shift assignments for the protein' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Soss, S.E.' 1 'Flynn, P.F.' 2 # _citation.id primary _citation.title 'Functional Implications for a Prototypical K-Turn Binding Protein from Structural and Dynamical Studies of 15.5K' _citation.journal_abbrev Biochemistry _citation.journal_volume 46 _citation.page_first 14979 _citation.page_last 14986 _citation.year 2007 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18044964 _citation.pdbx_database_id_DOI 10.1021/bi701254q # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Soss, S.E.' 1 ? primary 'Flynn, P.F.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'NHP2-like protein 1' _entity.formula_weight 16025.504 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'High mobility group-like nuclear protein 2 homolog 1, U4/U6.U5 tri-snRNP 15.5 kDa protein, OTK27, hSNU13' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSSGIEEGRMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLE IILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSSGIEEGRMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLE IILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 SER n 1 11 GLY n 1 12 ILE n 1 13 GLU n 1 14 GLU n 1 15 GLY n 1 16 ARG n 1 17 MET n 1 18 THR n 1 19 GLU n 1 20 ALA n 1 21 ASP n 1 22 VAL n 1 23 ASN n 1 24 PRO n 1 25 LYS n 1 26 ALA n 1 27 TYR n 1 28 PRO n 1 29 LEU n 1 30 ALA n 1 31 ASP n 1 32 ALA n 1 33 HIS n 1 34 LEU n 1 35 THR n 1 36 LYS n 1 37 LYS n 1 38 LEU n 1 39 LEU n 1 40 ASP n 1 41 LEU n 1 42 VAL n 1 43 GLN n 1 44 GLN n 1 45 SER n 1 46 CYS n 1 47 ASN n 1 48 TYR n 1 49 LYS n 1 50 GLN n 1 51 LEU n 1 52 ARG n 1 53 LYS n 1 54 GLY n 1 55 ALA n 1 56 ASN n 1 57 GLU n 1 58 ALA n 1 59 THR n 1 60 LYS n 1 61 THR n 1 62 LEU n 1 63 ASN n 1 64 ARG n 1 65 GLY n 1 66 ILE n 1 67 SER n 1 68 GLU n 1 69 PHE n 1 70 ILE n 1 71 VAL n 1 72 MET n 1 73 ALA n 1 74 ALA n 1 75 ASP n 1 76 ALA n 1 77 GLU n 1 78 PRO n 1 79 LEU n 1 80 GLU n 1 81 ILE n 1 82 ILE n 1 83 LEU n 1 84 HIS n 1 85 LEU n 1 86 PRO n 1 87 LEU n 1 88 LEU n 1 89 CYS n 1 90 GLU n 1 91 ASP n 1 92 LYS n 1 93 ASN n 1 94 VAL n 1 95 PRO n 1 96 TYR n 1 97 VAL n 1 98 PHE n 1 99 VAL n 1 100 ARG n 1 101 SER n 1 102 LYS n 1 103 GLN n 1 104 ALA n 1 105 LEU n 1 106 GLY n 1 107 ARG n 1 108 ALA n 1 109 CYS n 1 110 GLY n 1 111 VAL n 1 112 SER n 1 113 ARG n 1 114 PRO n 1 115 VAL n 1 116 ILE n 1 117 ALA n 1 118 CYS n 1 119 SER n 1 120 VAL n 1 121 THR n 1 122 ILE n 1 123 LYS n 1 124 GLU n 1 125 GLY n 1 126 SER n 1 127 GLN n 1 128 LEU n 1 129 LYS n 1 130 GLN n 1 131 GLN n 1 132 ILE n 1 133 GLN n 1 134 SER n 1 135 ILE n 1 136 GLN n 1 137 GLN n 1 138 SER n 1 139 ILE n 1 140 GLU n 1 141 ARG n 1 142 LEU n 1 143 LEU n 1 144 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene NHP2L1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET 11a' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -15 ? ? ? A . n A 1 2 GLY 2 -14 ? ? ? A . n A 1 3 HIS 3 -13 ? ? ? A . n A 1 4 HIS 4 -12 ? ? ? A . n A 1 5 HIS 5 -11 ? ? ? A . n A 1 6 HIS 6 -10 ? ? ? A . n A 1 7 HIS 7 -9 ? ? ? A . n A 1 8 HIS 8 -8 ? ? ? A . n A 1 9 SER 9 -7 ? ? ? A . n A 1 10 SER 10 -6 ? ? ? A . n A 1 11 GLY 11 -5 ? ? ? A . n A 1 12 ILE 12 -4 ? ? ? A . n A 1 13 GLU 13 -3 ? ? ? A . n A 1 14 GLU 14 -2 ? ? ? A . n A 1 15 GLY 15 -1 ? ? ? A . n A 1 16 ARG 16 0 ? ? ? A . n A 1 17 MET 17 1 1 MET MET A . n A 1 18 THR 18 2 2 THR THR A . n A 1 19 GLU 19 3 3 GLU GLU A . n A 1 20 ALA 20 4 4 ALA ALA A . n A 1 21 ASP 21 5 5 ASP ASP A . n A 1 22 VAL 22 6 6 VAL VAL A . n A 1 23 ASN 23 7 7 ASN ASN A . n A 1 24 PRO 24 8 8 PRO PRO A . n A 1 25 LYS 25 9 9 LYS LYS A . n A 1 26 ALA 26 10 10 ALA ALA A . n A 1 27 TYR 27 11 11 TYR TYR A . n A 1 28 PRO 28 12 12 PRO PRO A . n A 1 29 LEU 29 13 13 LEU LEU A . n A 1 30 ALA 30 14 14 ALA ALA A . n A 1 31 ASP 31 15 15 ASP ASP A . n A 1 32 ALA 32 16 16 ALA ALA A . n A 1 33 HIS 33 17 17 HIS HIS A . n A 1 34 LEU 34 18 18 LEU LEU A . n A 1 35 THR 35 19 19 THR THR A . n A 1 36 LYS 36 20 20 LYS LYS A . n A 1 37 LYS 37 21 21 LYS LYS A . n A 1 38 LEU 38 22 22 LEU LEU A . n A 1 39 LEU 39 23 23 LEU LEU A . n A 1 40 ASP 40 24 24 ASP ASP A . n A 1 41 LEU 41 25 25 LEU LEU A . n A 1 42 VAL 42 26 26 VAL VAL A . n A 1 43 GLN 43 27 27 GLN GLN A . n A 1 44 GLN 44 28 28 GLN GLN A . n A 1 45 SER 45 29 29 SER SER A . n A 1 46 CYS 46 30 30 CYS CYS A . n A 1 47 ASN 47 31 31 ASN ASN A . n A 1 48 TYR 48 32 32 TYR TYR A . n A 1 49 LYS 49 33 33 LYS LYS A . n A 1 50 GLN 50 34 34 GLN GLN A . n A 1 51 LEU 51 35 35 LEU LEU A . n A 1 52 ARG 52 36 36 ARG ARG A . n A 1 53 LYS 53 37 37 LYS LYS A . n A 1 54 GLY 54 38 38 GLY GLY A . n A 1 55 ALA 55 39 39 ALA ALA A . n A 1 56 ASN 56 40 40 ASN ASN A . n A 1 57 GLU 57 41 41 GLU GLU A . n A 1 58 ALA 58 42 42 ALA ALA A . n A 1 59 THR 59 43 43 THR THR A . n A 1 60 LYS 60 44 44 LYS LYS A . n A 1 61 THR 61 45 45 THR THR A . n A 1 62 LEU 62 46 46 LEU LEU A . n A 1 63 ASN 63 47 47 ASN ASN A . n A 1 64 ARG 64 48 48 ARG ARG A . n A 1 65 GLY 65 49 49 GLY GLY A . n A 1 66 ILE 66 50 50 ILE ILE A . n A 1 67 SER 67 51 51 SER SER A . n A 1 68 GLU 68 52 52 GLU GLU A . n A 1 69 PHE 69 53 53 PHE PHE A . n A 1 70 ILE 70 54 54 ILE ILE A . n A 1 71 VAL 71 55 55 VAL VAL A . n A 1 72 MET 72 56 56 MET MET A . n A 1 73 ALA 73 57 57 ALA ALA A . n A 1 74 ALA 74 58 58 ALA ALA A . n A 1 75 ASP 75 59 59 ASP ASP A . n A 1 76 ALA 76 60 60 ALA ALA A . n A 1 77 GLU 77 61 61 GLU GLU A . n A 1 78 PRO 78 62 62 PRO PRO A . n A 1 79 LEU 79 63 63 LEU LEU A . n A 1 80 GLU 80 64 64 GLU GLU A . n A 1 81 ILE 81 65 65 ILE ILE A . n A 1 82 ILE 82 66 66 ILE ILE A . n A 1 83 LEU 83 67 67 LEU LEU A . n A 1 84 HIS 84 68 68 HIS HIS A . n A 1 85 LEU 85 69 69 LEU LEU A . n A 1 86 PRO 86 70 70 PRO PRO A . n A 1 87 LEU 87 71 71 LEU LEU A . n A 1 88 LEU 88 72 72 LEU LEU A . n A 1 89 CYS 89 73 73 CYS CYS A . n A 1 90 GLU 90 74 74 GLU GLU A . n A 1 91 ASP 91 75 75 ASP ASP A . n A 1 92 LYS 92 76 76 LYS LYS A . n A 1 93 ASN 93 77 77 ASN ASN A . n A 1 94 VAL 94 78 78 VAL VAL A . n A 1 95 PRO 95 79 79 PRO PRO A . n A 1 96 TYR 96 80 80 TYR TYR A . n A 1 97 VAL 97 81 81 VAL VAL A . n A 1 98 PHE 98 82 82 PHE PHE A . n A 1 99 VAL 99 83 83 VAL VAL A . n A 1 100 ARG 100 84 84 ARG ARG A . n A 1 101 SER 101 85 85 SER SER A . n A 1 102 LYS 102 86 86 LYS LYS A . n A 1 103 GLN 103 87 87 GLN GLN A . n A 1 104 ALA 104 88 88 ALA ALA A . n A 1 105 LEU 105 89 89 LEU LEU A . n A 1 106 GLY 106 90 90 GLY GLY A . n A 1 107 ARG 107 91 91 ARG ARG A . n A 1 108 ALA 108 92 92 ALA ALA A . n A 1 109 CYS 109 93 93 CYS CYS A . n A 1 110 GLY 110 94 94 GLY GLY A . n A 1 111 VAL 111 95 95 VAL VAL A . n A 1 112 SER 112 96 96 SER SER A . n A 1 113 ARG 113 97 97 ARG ARG A . n A 1 114 PRO 114 98 98 PRO PRO A . n A 1 115 VAL 115 99 99 VAL VAL A . n A 1 116 ILE 116 100 100 ILE ILE A . n A 1 117 ALA 117 101 101 ALA ALA A . n A 1 118 CYS 118 102 102 CYS CYS A . n A 1 119 SER 119 103 103 SER SER A . n A 1 120 VAL 120 104 104 VAL VAL A . n A 1 121 THR 121 105 105 THR THR A . n A 1 122 ILE 122 106 106 ILE ILE A . n A 1 123 LYS 123 107 107 LYS LYS A . n A 1 124 GLU 124 108 108 GLU GLU A . n A 1 125 GLY 125 109 109 GLY GLY A . n A 1 126 SER 126 110 110 SER SER A . n A 1 127 GLN 127 111 111 GLN GLN A . n A 1 128 LEU 128 112 112 LEU LEU A . n A 1 129 LYS 129 113 113 LYS LYS A . n A 1 130 GLN 130 114 114 GLN GLN A . n A 1 131 GLN 131 115 115 GLN GLN A . n A 1 132 ILE 132 116 116 ILE ILE A . n A 1 133 GLN 133 117 117 GLN GLN A . n A 1 134 SER 134 118 118 SER SER A . n A 1 135 ILE 135 119 119 ILE ILE A . n A 1 136 GLN 136 120 120 GLN GLN A . n A 1 137 GLN 137 121 121 GLN GLN A . n A 1 138 SER 138 122 122 SER SER A . n A 1 139 ILE 139 123 123 ILE ILE A . n A 1 140 GLU 140 124 124 GLU GLU A . n A 1 141 ARG 141 125 125 ARG ARG A . n A 1 142 LEU 142 126 126 LEU LEU A . n A 1 143 LEU 143 127 127 LEU LEU A . n A 1 144 VAL 144 128 128 VAL VAL A . n # _cell.entry_id 2JNB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JNB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JNB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JNB _struct.title 'Solution Structure of RNA-binding protein 15.5K' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JNB _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'splicing, kink-turn RNA-binding protein, nhpx, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NH2L1_HUMAN _struct_ref.pdbx_db_accession P55769 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPY VFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JNB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 17 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55769 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JNB MET A 1 ? UNP P55769 ? ? 'expression tag' -15 1 1 2JNB GLY A 2 ? UNP P55769 ? ? 'expression tag' -14 2 1 2JNB HIS A 3 ? UNP P55769 ? ? 'expression tag' -13 3 1 2JNB HIS A 4 ? UNP P55769 ? ? 'expression tag' -12 4 1 2JNB HIS A 5 ? UNP P55769 ? ? 'expression tag' -11 5 1 2JNB HIS A 6 ? UNP P55769 ? ? 'expression tag' -10 6 1 2JNB HIS A 7 ? UNP P55769 ? ? 'expression tag' -9 7 1 2JNB HIS A 8 ? UNP P55769 ? ? 'expression tag' -8 8 1 2JNB SER A 9 ? UNP P55769 ? ? 'expression tag' -7 9 1 2JNB SER A 10 ? UNP P55769 ? ? 'expression tag' -6 10 1 2JNB GLY A 11 ? UNP P55769 ? ? 'expression tag' -5 11 1 2JNB ILE A 12 ? UNP P55769 ? ? 'expression tag' -4 12 1 2JNB GLU A 13 ? UNP P55769 ? ? 'expression tag' -3 13 1 2JNB GLU A 14 ? UNP P55769 ? ? 'expression tag' -2 14 1 2JNB GLY A 15 ? UNP P55769 ? ? 'expression tag' -1 15 1 2JNB ARG A 16 ? UNP P55769 ? ? 'expression tag' 0 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 31 ? TYR A 48 ? ASP A 15 TYR A 32 1 ? 18 HELX_P HELX_P2 2 GLY A 54 ? ARG A 64 ? GLY A 38 ARG A 48 1 ? 11 HELX_P HELX_P3 3 LEU A 79 ? LEU A 85 ? LEU A 63 LEU A 69 1 ? 7 HELX_P HELX_P4 4 LYS A 102 ? GLY A 110 ? LYS A 86 GLY A 94 1 ? 9 HELX_P HELX_P5 5 LEU A 128 ? VAL A 144 ? LEU A 112 VAL A 128 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 1 0.00 2 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 1 0.03 3 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 2 -0.08 4 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 2 0.02 5 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 3 -0.04 6 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 3 -0.01 7 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 4 -0.06 8 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 4 0.10 9 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 5 -0.08 10 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 5 -0.02 11 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 6 -0.10 12 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 6 -0.03 13 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 7 -0.13 14 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 7 -0.04 15 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 8 -0.14 16 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 8 -0.04 17 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 9 -0.04 18 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 9 -0.09 19 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 10 -0.16 20 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 10 0.00 21 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 11 -0.04 22 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 11 0.19 23 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 12 0.01 24 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 12 -0.01 25 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 13 -0.01 26 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 13 -0.02 27 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 14 -0.02 28 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 14 -0.06 29 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 15 0.03 30 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 15 -0.02 31 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 16 -0.13 32 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 16 -0.05 33 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 17 -0.01 34 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 17 -0.06 35 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 18 0.03 36 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 18 -0.13 37 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 19 -0.07 38 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 19 -0.06 39 TYR 27 A . ? TYR 11 A PRO 28 A ? PRO 12 A 20 -0.06 40 GLU 77 A . ? GLU 61 A PRO 78 A ? PRO 62 A 20 0.03 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 51 ? LYS A 53 ? LEU A 35 LYS A 37 A 2 TYR A 96 ? VAL A 99 ? TYR A 80 VAL A 83 A 3 SER A 67 ? ALA A 73 ? SER A 51 ALA A 57 A 4 ALA A 117 ? THR A 121 ? ALA A 101 THR A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 2 3 O VAL A 97 ? O VAL A 81 N MET A 72 ? N MET A 56 A 3 4 N VAL A 71 ? N VAL A 55 O CYS A 118 ? O CYS A 102 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? -164.35 113.63 2 1 GLU A 3 ? ? -152.16 26.62 3 1 ASP A 15 ? ? -56.52 175.93 4 1 LYS A 37 ? ? -150.58 81.72 5 1 ILE A 50 ? ? -145.06 20.09 6 1 LEU A 72 ? ? -111.75 -74.55 7 1 CYS A 73 ? ? -171.90 -171.93 8 1 ASN A 77 ? ? 65.71 89.33 9 1 VAL A 78 ? ? -150.36 89.83 10 1 TYR A 80 ? ? -174.21 139.33 11 1 SER A 85 ? ? -172.23 117.50 12 2 GLU A 3 ? ? -165.70 50.40 13 2 ASP A 5 ? ? -92.45 56.30 14 2 PRO A 8 ? ? -69.72 90.42 15 2 ALA A 10 ? ? -155.45 33.11 16 2 ILE A 50 ? ? -143.64 15.26 17 2 LEU A 72 ? ? -111.48 -73.90 18 2 CYS A 73 ? ? -171.11 -163.51 19 2 ASN A 77 ? ? 64.39 87.50 20 2 VAL A 81 ? ? -172.53 135.17 21 2 SER A 85 ? ? -176.61 141.35 22 3 GLU A 3 ? ? -171.64 46.29 23 3 ASP A 5 ? ? -108.06 59.44 24 3 ARG A 36 ? ? -160.89 109.85 25 3 ILE A 50 ? ? -145.03 19.50 26 3 LEU A 72 ? ? -111.70 -74.59 27 3 CYS A 73 ? ? -171.73 -169.32 28 3 ASN A 77 ? ? 64.91 88.21 29 3 VAL A 78 ? ? -150.13 89.79 30 3 ARG A 84 ? ? -106.32 57.32 31 3 SER A 85 ? ? 65.21 106.08 32 3 ALA A 101 ? ? -165.22 116.89 33 4 THR A 2 ? ? -167.45 118.16 34 4 GLU A 3 ? ? -160.88 63.75 35 4 ASP A 5 ? ? -172.33 67.72 36 4 PRO A 70 ? ? -69.72 99.02 37 4 CYS A 73 ? ? -57.27 -177.52 38 4 ASN A 77 ? ? 63.89 78.26 39 4 ARG A 84 ? ? -99.44 55.34 40 4 SER A 85 ? ? -166.53 114.77 41 5 THR A 2 ? ? -177.48 126.81 42 5 ASP A 5 ? ? -148.02 -76.21 43 5 PRO A 8 ? ? -69.79 90.60 44 5 ILE A 50 ? ? -144.83 18.25 45 5 PHE A 53 ? ? -174.41 145.07 46 5 LEU A 72 ? ? -111.56 -74.24 47 5 CYS A 73 ? ? -171.53 -169.28 48 5 ASN A 77 ? ? 64.95 88.28 49 5 VAL A 78 ? ? -150.27 89.90 50 5 TYR A 80 ? ? -174.08 148.15 51 5 SER A 85 ? ? -178.64 98.83 52 6 THR A 2 ? ? -160.46 112.90 53 6 GLU A 3 ? ? -141.99 40.78 54 6 ALA A 4 ? ? 54.41 -172.78 55 6 PRO A 8 ? ? -69.76 78.39 56 6 ALA A 10 ? ? -163.82 63.02 57 6 TYR A 11 ? ? -160.07 97.32 58 6 ARG A 36 ? ? -170.28 117.72 59 6 LEU A 72 ? ? -111.81 -74.48 60 6 CYS A 73 ? ? -171.91 -169.21 61 6 ASN A 77 ? ? 64.83 84.41 62 6 ARG A 84 ? ? -90.67 47.48 63 6 LYS A 86 ? ? -101.54 -64.62 64 7 GLU A 3 ? ? -144.77 44.63 65 7 ASP A 5 ? ? -83.05 -76.13 66 7 VAL A 6 ? ? 65.19 151.96 67 7 LYS A 9 ? ? -91.68 49.52 68 7 ALA A 10 ? ? -152.38 26.24 69 7 ILE A 50 ? ? -141.93 11.69 70 7 ASP A 59 ? ? -98.44 35.00 71 7 LEU A 72 ? ? -111.40 -74.04 72 7 CYS A 73 ? ? -171.35 -169.00 73 7 ASN A 77 ? ? 65.11 88.75 74 7 VAL A 81 ? ? -175.95 135.15 75 7 SER A 85 ? ? -175.68 99.58 76 7 ALA A 101 ? ? -162.44 116.97 77 7 LEU A 127 ? ? -71.97 -74.13 78 8 GLU A 3 ? ? -157.81 35.73 79 8 ASP A 5 ? ? -148.38 41.32 80 8 ILE A 50 ? ? -145.01 18.96 81 8 PHE A 53 ? ? -174.37 141.79 82 8 LEU A 72 ? ? -111.81 -74.77 83 8 CYS A 73 ? ? -171.92 -169.62 84 8 ASN A 77 ? ? 65.04 86.59 85 8 VAL A 81 ? ? -176.95 135.04 86 8 SER A 85 ? ? -163.85 116.00 87 8 LYS A 86 ? ? -94.58 -62.05 88 9 ALA A 4 ? ? 62.50 176.25 89 9 ASP A 59 ? ? -95.88 34.17 90 9 LEU A 72 ? ? -111.74 -74.64 91 9 ASN A 77 ? ? 66.51 90.27 92 9 ARG A 84 ? ? -94.97 52.23 93 9 LYS A 86 ? ? -130.76 -40.15 94 9 SER A 96 ? ? -96.14 30.49 95 9 PRO A 98 ? ? -69.78 98.84 96 10 GLU A 3 ? ? -156.30 32.06 97 10 ALA A 4 ? ? -105.08 58.14 98 10 ASP A 15 ? ? -54.44 171.32 99 10 ILE A 50 ? ? -142.39 19.17 100 10 PRO A 70 ? ? -69.80 -172.69 101 10 LEU A 72 ? ? -112.27 -74.54 102 10 CYS A 73 ? ? -171.97 -173.22 103 10 ASN A 77 ? ? 67.57 95.59 104 10 ARG A 84 ? ? -95.03 40.58 105 11 ASP A 5 ? ? -105.92 57.74 106 11 ALA A 10 ? ? -96.01 39.64 107 11 ASP A 15 ? ? -54.19 171.89 108 11 ARG A 36 ? ? -169.82 118.19 109 11 ILE A 50 ? ? -143.30 13.00 110 11 LEU A 72 ? ? -111.11 -73.74 111 11 CYS A 73 ? ? -170.95 -168.99 112 11 ASN A 77 ? ? 64.94 86.05 113 11 SER A 85 ? ? -176.06 94.06 114 12 GLU A 3 ? ? -151.42 48.68 115 12 ALA A 4 ? ? 58.10 177.84 116 12 ASP A 5 ? ? -142.02 48.82 117 12 VAL A 6 ? ? 35.48 73.56 118 12 PRO A 8 ? ? -69.76 -173.42 119 12 LYS A 37 ? ? -155.01 81.68 120 12 LEU A 72 ? ? -112.25 -74.52 121 12 CYS A 73 ? ? -171.89 -167.36 122 12 ASN A 77 ? ? 66.55 91.93 123 12 VAL A 78 ? ? -150.18 89.72 124 12 ARG A 84 ? ? -109.14 49.99 125 12 SER A 85 ? ? -177.21 147.18 126 13 ASP A 5 ? ? -101.01 -76.29 127 13 LYS A 9 ? ? -89.31 48.96 128 13 ALA A 10 ? ? -157.39 32.23 129 13 LEU A 72 ? ? -111.73 -74.52 130 13 PRO A 79 ? ? -69.74 77.76 131 14 THR A 2 ? ? 55.63 70.55 132 14 GLU A 3 ? ? -174.18 69.23 133 14 ASP A 5 ? ? -161.72 36.30 134 14 ILE A 50 ? ? -144.93 19.67 135 14 LEU A 72 ? ? -111.13 -73.33 136 14 ASN A 77 ? ? 169.54 37.14 137 14 PRO A 79 ? ? -69.84 88.33 138 14 ARG A 84 ? ? -101.15 41.68 139 14 SER A 85 ? ? -174.03 132.03 140 15 THR A 2 ? ? 62.36 97.29 141 15 GLU A 3 ? ? -171.89 113.76 142 15 ALA A 10 ? ? 64.74 66.60 143 15 TYR A 11 ? ? -160.27 98.27 144 15 ARG A 36 ? ? -160.07 117.59 145 15 LEU A 72 ? ? -112.04 -74.81 146 15 CYS A 73 ? ? -172.00 -172.35 147 15 ASN A 77 ? ? 66.04 89.89 148 15 VAL A 78 ? ? -150.11 89.82 149 15 TYR A 80 ? ? -179.32 144.40 150 16 GLU A 3 ? ? -172.96 37.48 151 16 ILE A 50 ? ? -144.16 18.75 152 16 LEU A 72 ? ? -110.57 -73.00 153 16 ASN A 77 ? ? 165.18 54.97 154 16 VAL A 78 ? ? -151.47 89.25 155 16 VAL A 81 ? ? -172.51 135.07 156 16 LYS A 86 ? ? -159.82 -49.16 157 17 THR A 2 ? ? -177.86 122.76 158 17 GLU A 3 ? ? -162.62 30.05 159 17 ALA A 4 ? ? 62.50 97.75 160 17 ASP A 5 ? ? -167.68 73.52 161 17 VAL A 6 ? ? -99.90 37.90 162 17 ARG A 36 ? ? -165.09 116.18 163 17 ILE A 50 ? ? -142.94 20.76 164 17 LEU A 72 ? ? -111.21 -73.81 165 17 CYS A 73 ? ? -171.08 -171.90 166 17 ASN A 77 ? ? 65.93 90.22 167 17 VAL A 81 ? ? -177.34 135.32 168 17 SER A 85 ? ? -179.23 141.20 169 17 LYS A 86 ? ? -136.39 -42.28 170 17 SER A 96 ? ? -89.50 49.45 171 18 GLU A 3 ? ? -172.21 36.18 172 18 ARG A 36 ? ? -161.50 111.46 173 18 LEU A 72 ? ? -110.85 -73.03 174 18 ASN A 77 ? ? 167.07 37.54 175 18 PRO A 79 ? ? -69.70 89.48 176 18 ARG A 84 ? ? -92.03 52.21 177 18 SER A 85 ? ? -163.03 113.78 178 19 THR A 2 ? ? -176.67 125.92 179 19 GLU A 3 ? ? -170.74 97.66 180 19 PRO A 8 ? ? -69.81 -171.00 181 19 ALA A 10 ? ? -94.80 36.26 182 19 ASP A 15 ? ? -65.96 -177.88 183 19 LYS A 37 ? ? -157.21 81.76 184 19 CYS A 73 ? ? -58.64 -174.42 185 19 ASN A 77 ? ? 62.26 77.58 186 19 ARG A 84 ? ? -113.47 52.80 187 20 GLU A 3 ? ? -164.30 117.71 188 20 ASP A 5 ? ? -179.19 93.82 189 20 TYR A 11 ? ? -160.40 95.97 190 20 ILE A 50 ? ? -140.03 19.08 191 20 PHE A 53 ? ? -174.14 134.75 192 20 LEU A 72 ? ? -112.05 -74.97 193 20 CYS A 73 ? ? -172.03 144.90 194 20 ASN A 77 ? ? 165.25 65.69 195 20 VAL A 78 ? ? -151.38 89.55 196 20 ARG A 84 ? ? -93.63 41.52 197 20 LEU A 127 ? ? -59.66 -70.97 # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR ; 700 ;SHEET DETERMINATION METHOD: AUTHOR ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JNB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.35 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.25 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JNB _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.1 % sodium azide, 100 mM sodium chloride, 100 mM sodium phosphate, 1.6 mM protein, 90% H2O, 10% D2O' 1 '90% H2O/10% D2O' '0.1 % sodium azide, 200 mM sodium chloride, 50 mM sodium phosphate, 0.9 mM [U-98% 13C, U-98% 15N] protein, 90% H2O, 10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium azide' 0.1 % ? 1 'sodium chloride' 100 mM ? 1 'sodium phosphate' 100 mM ? 1 entity 1.6 mM ? 1 'sodium azide' 0.1 % ? 2 'sodium chloride' 200 mM ? 2 'sodium phosphate' 50 mM ? 2 entity .9 mM '[U-98% 13C; U-98% 15N]' 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 250 6.0 ambient ? 293 K 2 200 6.0 ambient ? 293 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 2 '3D CBCA(CO)NH' 1 3 2 '3D HNCO' 1 4 2 '3D HNCA' 1 5 2 '3D HNCACB' 1 6 2 '3D HN(CO)CA' 2 7 1 '2D 1H-13C HSQC' 2 8 1 '3D C(CO)NH' 2 9 1 '3D HBHA(CO)NH' 2 10 1 '3D HCCH-TOCSY' 2 11 1 '3D HCCH-COSY' 2 12 1 '3D 1H-15N NOESY' 2 13 1 '3D 1H-13C NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JNB _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1090 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count 229 _pdbx_nmr_constraints.NOE_medium_range_total_count 148 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 100 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 100 # _pdbx_nmr_refine.entry_id 2JNB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Accelrys Software Inc.' processing Felix 97.0 1 Goddard 'chemical shift assignment' Sparky 3.111 2 Goddard 'peak picking' Sparky 3.111 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 5 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 7 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -15 ? A MET 1 2 1 Y 1 A GLY -14 ? A GLY 2 3 1 Y 1 A HIS -13 ? A HIS 3 4 1 Y 1 A HIS -12 ? A HIS 4 5 1 Y 1 A HIS -11 ? A HIS 5 6 1 Y 1 A HIS -10 ? A HIS 6 7 1 Y 1 A HIS -9 ? A HIS 7 8 1 Y 1 A HIS -8 ? A HIS 8 9 1 Y 1 A SER -7 ? A SER 9 10 1 Y 1 A SER -6 ? A SER 10 11 1 Y 1 A GLY -5 ? A GLY 11 12 1 Y 1 A ILE -4 ? A ILE 12 13 1 Y 1 A GLU -3 ? A GLU 13 14 1 Y 1 A GLU -2 ? A GLU 14 15 1 Y 1 A GLY -1 ? A GLY 15 16 1 Y 1 A ARG 0 ? A ARG 16 17 2 Y 1 A MET -15 ? A MET 1 18 2 Y 1 A GLY -14 ? A GLY 2 19 2 Y 1 A HIS -13 ? A HIS 3 20 2 Y 1 A HIS -12 ? A HIS 4 21 2 Y 1 A HIS -11 ? A HIS 5 22 2 Y 1 A HIS -10 ? A HIS 6 23 2 Y 1 A HIS -9 ? A HIS 7 24 2 Y 1 A HIS -8 ? A HIS 8 25 2 Y 1 A SER -7 ? A SER 9 26 2 Y 1 A SER -6 ? A SER 10 27 2 Y 1 A GLY -5 ? A GLY 11 28 2 Y 1 A ILE -4 ? A ILE 12 29 2 Y 1 A GLU -3 ? A GLU 13 30 2 Y 1 A GLU -2 ? A GLU 14 31 2 Y 1 A GLY -1 ? A GLY 15 32 2 Y 1 A ARG 0 ? A ARG 16 33 3 Y 1 A MET -15 ? A MET 1 34 3 Y 1 A GLY -14 ? A GLY 2 35 3 Y 1 A HIS -13 ? A HIS 3 36 3 Y 1 A HIS -12 ? A HIS 4 37 3 Y 1 A HIS -11 ? A HIS 5 38 3 Y 1 A HIS -10 ? A HIS 6 39 3 Y 1 A HIS -9 ? A HIS 7 40 3 Y 1 A HIS -8 ? A HIS 8 41 3 Y 1 A SER -7 ? A SER 9 42 3 Y 1 A SER -6 ? A SER 10 43 3 Y 1 A GLY -5 ? A GLY 11 44 3 Y 1 A ILE -4 ? A ILE 12 45 3 Y 1 A GLU -3 ? A GLU 13 46 3 Y 1 A GLU -2 ? A GLU 14 47 3 Y 1 A GLY -1 ? A GLY 15 48 3 Y 1 A ARG 0 ? A ARG 16 49 4 Y 1 A MET -15 ? A MET 1 50 4 Y 1 A GLY -14 ? A GLY 2 51 4 Y 1 A HIS -13 ? A HIS 3 52 4 Y 1 A HIS -12 ? A HIS 4 53 4 Y 1 A HIS -11 ? A HIS 5 54 4 Y 1 A HIS -10 ? A HIS 6 55 4 Y 1 A HIS -9 ? A HIS 7 56 4 Y 1 A HIS -8 ? A HIS 8 57 4 Y 1 A SER -7 ? A SER 9 58 4 Y 1 A SER -6 ? A SER 10 59 4 Y 1 A GLY -5 ? A GLY 11 60 4 Y 1 A ILE -4 ? A ILE 12 61 4 Y 1 A GLU -3 ? A GLU 13 62 4 Y 1 A GLU -2 ? A GLU 14 63 4 Y 1 A GLY -1 ? A GLY 15 64 4 Y 1 A ARG 0 ? A ARG 16 65 5 Y 1 A MET -15 ? A MET 1 66 5 Y 1 A GLY -14 ? A GLY 2 67 5 Y 1 A HIS -13 ? A HIS 3 68 5 Y 1 A HIS -12 ? A HIS 4 69 5 Y 1 A HIS -11 ? A HIS 5 70 5 Y 1 A HIS -10 ? A HIS 6 71 5 Y 1 A HIS -9 ? A HIS 7 72 5 Y 1 A HIS -8 ? A HIS 8 73 5 Y 1 A SER -7 ? A SER 9 74 5 Y 1 A SER -6 ? A SER 10 75 5 Y 1 A GLY -5 ? A GLY 11 76 5 Y 1 A ILE -4 ? A ILE 12 77 5 Y 1 A GLU -3 ? A GLU 13 78 5 Y 1 A GLU -2 ? A GLU 14 79 5 Y 1 A GLY -1 ? A GLY 15 80 5 Y 1 A ARG 0 ? A ARG 16 81 6 Y 1 A MET -15 ? A MET 1 82 6 Y 1 A GLY -14 ? A GLY 2 83 6 Y 1 A HIS -13 ? A HIS 3 84 6 Y 1 A HIS -12 ? A HIS 4 85 6 Y 1 A HIS -11 ? A HIS 5 86 6 Y 1 A HIS -10 ? A HIS 6 87 6 Y 1 A HIS -9 ? A HIS 7 88 6 Y 1 A HIS -8 ? A HIS 8 89 6 Y 1 A SER -7 ? A SER 9 90 6 Y 1 A SER -6 ? A SER 10 91 6 Y 1 A GLY -5 ? A GLY 11 92 6 Y 1 A ILE -4 ? A ILE 12 93 6 Y 1 A GLU -3 ? A GLU 13 94 6 Y 1 A GLU -2 ? A GLU 14 95 6 Y 1 A GLY -1 ? A GLY 15 96 6 Y 1 A ARG 0 ? A ARG 16 97 7 Y 1 A MET -15 ? A MET 1 98 7 Y 1 A GLY -14 ? A GLY 2 99 7 Y 1 A HIS -13 ? A HIS 3 100 7 Y 1 A HIS -12 ? A HIS 4 101 7 Y 1 A HIS -11 ? A HIS 5 102 7 Y 1 A HIS -10 ? A HIS 6 103 7 Y 1 A HIS -9 ? A HIS 7 104 7 Y 1 A HIS -8 ? A HIS 8 105 7 Y 1 A SER -7 ? A SER 9 106 7 Y 1 A SER -6 ? A SER 10 107 7 Y 1 A GLY -5 ? A GLY 11 108 7 Y 1 A ILE -4 ? A ILE 12 109 7 Y 1 A GLU -3 ? A GLU 13 110 7 Y 1 A GLU -2 ? A GLU 14 111 7 Y 1 A GLY -1 ? A GLY 15 112 7 Y 1 A ARG 0 ? A ARG 16 113 8 Y 1 A MET -15 ? A MET 1 114 8 Y 1 A GLY -14 ? A GLY 2 115 8 Y 1 A HIS -13 ? A HIS 3 116 8 Y 1 A HIS -12 ? A HIS 4 117 8 Y 1 A HIS -11 ? A HIS 5 118 8 Y 1 A HIS -10 ? A HIS 6 119 8 Y 1 A HIS -9 ? A HIS 7 120 8 Y 1 A HIS -8 ? A HIS 8 121 8 Y 1 A SER -7 ? A SER 9 122 8 Y 1 A SER -6 ? A SER 10 123 8 Y 1 A GLY -5 ? A GLY 11 124 8 Y 1 A ILE -4 ? A ILE 12 125 8 Y 1 A GLU -3 ? A GLU 13 126 8 Y 1 A GLU -2 ? A GLU 14 127 8 Y 1 A GLY -1 ? A GLY 15 128 8 Y 1 A ARG 0 ? A ARG 16 129 9 Y 1 A MET -15 ? A MET 1 130 9 Y 1 A GLY -14 ? A GLY 2 131 9 Y 1 A HIS -13 ? A HIS 3 132 9 Y 1 A HIS -12 ? A HIS 4 133 9 Y 1 A HIS -11 ? A HIS 5 134 9 Y 1 A HIS -10 ? A HIS 6 135 9 Y 1 A HIS -9 ? A HIS 7 136 9 Y 1 A HIS -8 ? A HIS 8 137 9 Y 1 A SER -7 ? A SER 9 138 9 Y 1 A SER -6 ? A SER 10 139 9 Y 1 A GLY -5 ? A GLY 11 140 9 Y 1 A ILE -4 ? A ILE 12 141 9 Y 1 A GLU -3 ? A GLU 13 142 9 Y 1 A GLU -2 ? A GLU 14 143 9 Y 1 A GLY -1 ? A GLY 15 144 9 Y 1 A ARG 0 ? A ARG 16 145 10 Y 1 A MET -15 ? A MET 1 146 10 Y 1 A GLY -14 ? A GLY 2 147 10 Y 1 A HIS -13 ? A HIS 3 148 10 Y 1 A HIS -12 ? A HIS 4 149 10 Y 1 A HIS -11 ? A HIS 5 150 10 Y 1 A HIS -10 ? A HIS 6 151 10 Y 1 A HIS -9 ? A HIS 7 152 10 Y 1 A HIS -8 ? A HIS 8 153 10 Y 1 A SER -7 ? A SER 9 154 10 Y 1 A SER -6 ? A SER 10 155 10 Y 1 A GLY -5 ? A GLY 11 156 10 Y 1 A ILE -4 ? A ILE 12 157 10 Y 1 A GLU -3 ? A GLU 13 158 10 Y 1 A GLU -2 ? A GLU 14 159 10 Y 1 A GLY -1 ? A GLY 15 160 10 Y 1 A ARG 0 ? A ARG 16 161 11 Y 1 A MET -15 ? A MET 1 162 11 Y 1 A GLY -14 ? A GLY 2 163 11 Y 1 A HIS -13 ? A HIS 3 164 11 Y 1 A HIS -12 ? A HIS 4 165 11 Y 1 A HIS -11 ? A HIS 5 166 11 Y 1 A HIS -10 ? A HIS 6 167 11 Y 1 A HIS -9 ? A HIS 7 168 11 Y 1 A HIS -8 ? A HIS 8 169 11 Y 1 A SER -7 ? A SER 9 170 11 Y 1 A SER -6 ? A SER 10 171 11 Y 1 A GLY -5 ? A GLY 11 172 11 Y 1 A ILE -4 ? A ILE 12 173 11 Y 1 A GLU -3 ? A GLU 13 174 11 Y 1 A GLU -2 ? A GLU 14 175 11 Y 1 A GLY -1 ? A GLY 15 176 11 Y 1 A ARG 0 ? A ARG 16 177 12 Y 1 A MET -15 ? A MET 1 178 12 Y 1 A GLY -14 ? A GLY 2 179 12 Y 1 A HIS -13 ? A HIS 3 180 12 Y 1 A HIS -12 ? A HIS 4 181 12 Y 1 A HIS -11 ? A HIS 5 182 12 Y 1 A HIS -10 ? A HIS 6 183 12 Y 1 A HIS -9 ? A HIS 7 184 12 Y 1 A HIS -8 ? A HIS 8 185 12 Y 1 A SER -7 ? A SER 9 186 12 Y 1 A SER -6 ? A SER 10 187 12 Y 1 A GLY -5 ? A GLY 11 188 12 Y 1 A ILE -4 ? A ILE 12 189 12 Y 1 A GLU -3 ? A GLU 13 190 12 Y 1 A GLU -2 ? A GLU 14 191 12 Y 1 A GLY -1 ? A GLY 15 192 12 Y 1 A ARG 0 ? A ARG 16 193 13 Y 1 A MET -15 ? A MET 1 194 13 Y 1 A GLY -14 ? A GLY 2 195 13 Y 1 A HIS -13 ? A HIS 3 196 13 Y 1 A HIS -12 ? A HIS 4 197 13 Y 1 A HIS -11 ? A HIS 5 198 13 Y 1 A HIS -10 ? A HIS 6 199 13 Y 1 A HIS -9 ? A HIS 7 200 13 Y 1 A HIS -8 ? A HIS 8 201 13 Y 1 A SER -7 ? A SER 9 202 13 Y 1 A SER -6 ? A SER 10 203 13 Y 1 A GLY -5 ? A GLY 11 204 13 Y 1 A ILE -4 ? A ILE 12 205 13 Y 1 A GLU -3 ? A GLU 13 206 13 Y 1 A GLU -2 ? A GLU 14 207 13 Y 1 A GLY -1 ? A GLY 15 208 13 Y 1 A ARG 0 ? A ARG 16 209 14 Y 1 A MET -15 ? A MET 1 210 14 Y 1 A GLY -14 ? A GLY 2 211 14 Y 1 A HIS -13 ? A HIS 3 212 14 Y 1 A HIS -12 ? A HIS 4 213 14 Y 1 A HIS -11 ? A HIS 5 214 14 Y 1 A HIS -10 ? A HIS 6 215 14 Y 1 A HIS -9 ? A HIS 7 216 14 Y 1 A HIS -8 ? A HIS 8 217 14 Y 1 A SER -7 ? A SER 9 218 14 Y 1 A SER -6 ? A SER 10 219 14 Y 1 A GLY -5 ? A GLY 11 220 14 Y 1 A ILE -4 ? A ILE 12 221 14 Y 1 A GLU -3 ? A GLU 13 222 14 Y 1 A GLU -2 ? A GLU 14 223 14 Y 1 A GLY -1 ? A GLY 15 224 14 Y 1 A ARG 0 ? A ARG 16 225 15 Y 1 A MET -15 ? A MET 1 226 15 Y 1 A GLY -14 ? A GLY 2 227 15 Y 1 A HIS -13 ? A HIS 3 228 15 Y 1 A HIS -12 ? A HIS 4 229 15 Y 1 A HIS -11 ? A HIS 5 230 15 Y 1 A HIS -10 ? A HIS 6 231 15 Y 1 A HIS -9 ? A HIS 7 232 15 Y 1 A HIS -8 ? A HIS 8 233 15 Y 1 A SER -7 ? A SER 9 234 15 Y 1 A SER -6 ? A SER 10 235 15 Y 1 A GLY -5 ? A GLY 11 236 15 Y 1 A ILE -4 ? A ILE 12 237 15 Y 1 A GLU -3 ? A GLU 13 238 15 Y 1 A GLU -2 ? A GLU 14 239 15 Y 1 A GLY -1 ? A GLY 15 240 15 Y 1 A ARG 0 ? A ARG 16 241 16 Y 1 A MET -15 ? A MET 1 242 16 Y 1 A GLY -14 ? A GLY 2 243 16 Y 1 A HIS -13 ? A HIS 3 244 16 Y 1 A HIS -12 ? A HIS 4 245 16 Y 1 A HIS -11 ? A HIS 5 246 16 Y 1 A HIS -10 ? A HIS 6 247 16 Y 1 A HIS -9 ? A HIS 7 248 16 Y 1 A HIS -8 ? A HIS 8 249 16 Y 1 A SER -7 ? A SER 9 250 16 Y 1 A SER -6 ? A SER 10 251 16 Y 1 A GLY -5 ? A GLY 11 252 16 Y 1 A ILE -4 ? A ILE 12 253 16 Y 1 A GLU -3 ? A GLU 13 254 16 Y 1 A GLU -2 ? A GLU 14 255 16 Y 1 A GLY -1 ? A GLY 15 256 16 Y 1 A ARG 0 ? A ARG 16 257 17 Y 1 A MET -15 ? A MET 1 258 17 Y 1 A GLY -14 ? A GLY 2 259 17 Y 1 A HIS -13 ? A HIS 3 260 17 Y 1 A HIS -12 ? A HIS 4 261 17 Y 1 A HIS -11 ? A HIS 5 262 17 Y 1 A HIS -10 ? A HIS 6 263 17 Y 1 A HIS -9 ? A HIS 7 264 17 Y 1 A HIS -8 ? A HIS 8 265 17 Y 1 A SER -7 ? A SER 9 266 17 Y 1 A SER -6 ? A SER 10 267 17 Y 1 A GLY -5 ? A GLY 11 268 17 Y 1 A ILE -4 ? A ILE 12 269 17 Y 1 A GLU -3 ? A GLU 13 270 17 Y 1 A GLU -2 ? A GLU 14 271 17 Y 1 A GLY -1 ? A GLY 15 272 17 Y 1 A ARG 0 ? A ARG 16 273 18 Y 1 A MET -15 ? A MET 1 274 18 Y 1 A GLY -14 ? A GLY 2 275 18 Y 1 A HIS -13 ? A HIS 3 276 18 Y 1 A HIS -12 ? A HIS 4 277 18 Y 1 A HIS -11 ? A HIS 5 278 18 Y 1 A HIS -10 ? A HIS 6 279 18 Y 1 A HIS -9 ? A HIS 7 280 18 Y 1 A HIS -8 ? A HIS 8 281 18 Y 1 A SER -7 ? A SER 9 282 18 Y 1 A SER -6 ? A SER 10 283 18 Y 1 A GLY -5 ? A GLY 11 284 18 Y 1 A ILE -4 ? A ILE 12 285 18 Y 1 A GLU -3 ? A GLU 13 286 18 Y 1 A GLU -2 ? A GLU 14 287 18 Y 1 A GLY -1 ? A GLY 15 288 18 Y 1 A ARG 0 ? A ARG 16 289 19 Y 1 A MET -15 ? A MET 1 290 19 Y 1 A GLY -14 ? A GLY 2 291 19 Y 1 A HIS -13 ? A HIS 3 292 19 Y 1 A HIS -12 ? A HIS 4 293 19 Y 1 A HIS -11 ? A HIS 5 294 19 Y 1 A HIS -10 ? A HIS 6 295 19 Y 1 A HIS -9 ? A HIS 7 296 19 Y 1 A HIS -8 ? A HIS 8 297 19 Y 1 A SER -7 ? A SER 9 298 19 Y 1 A SER -6 ? A SER 10 299 19 Y 1 A GLY -5 ? A GLY 11 300 19 Y 1 A ILE -4 ? A ILE 12 301 19 Y 1 A GLU -3 ? A GLU 13 302 19 Y 1 A GLU -2 ? A GLU 14 303 19 Y 1 A GLY -1 ? A GLY 15 304 19 Y 1 A ARG 0 ? A ARG 16 305 20 Y 1 A MET -15 ? A MET 1 306 20 Y 1 A GLY -14 ? A GLY 2 307 20 Y 1 A HIS -13 ? A HIS 3 308 20 Y 1 A HIS -12 ? A HIS 4 309 20 Y 1 A HIS -11 ? A HIS 5 310 20 Y 1 A HIS -10 ? A HIS 6 311 20 Y 1 A HIS -9 ? A HIS 7 312 20 Y 1 A HIS -8 ? A HIS 8 313 20 Y 1 A SER -7 ? A SER 9 314 20 Y 1 A SER -6 ? A SER 10 315 20 Y 1 A GLY -5 ? A GLY 11 316 20 Y 1 A ILE -4 ? A ILE 12 317 20 Y 1 A GLU -3 ? A GLU 13 318 20 Y 1 A GLU -2 ? A GLU 14 319 20 Y 1 A GLY -1 ? A GLY 15 320 20 Y 1 A ARG 0 ? A ARG 16 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2JNB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_