data_2JOO # _entry.id 2JOO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JOO pdb_00002joo 10.2210/pdb2joo/pdb RCSB RCSB100096 ? ? WWPDB D_1000100096 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-03-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 4 'Structure model' 1 3 2023-12-20 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' Other 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_database_status 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JOO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-03-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Song, X.' 1 'Mo, W.' 2 'Liu, X.' 3 'Yan, X.' 4 'Song, H.' 5 'Dai, L.' 6 # _citation.id primary _citation.title 'The NMR solution structure of recombinant RGD-hirudin' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 360 _citation.page_first 103 _citation.page_last 108 _citation.year 2007 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17585879 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2007.06.014 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, X.' 1 ? primary 'Mo, W.' 2 ? primary 'Liu, X.' 3 ? primary 'Zhu, L.' 4 ? primary 'Yan, X.' 5 ? primary 'Song, H.' 6 ? primary 'Dai, L.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hirudin variant-1' _entity.formula_weight 7042.593 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Lepirudin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGRGDSKNQCVTGEGTPKPQSHNQGDFEPIPEDAYDE _entity_poly.pdbx_seq_one_letter_code_can VVYTDCTESGQNLCLCEGSNVCGQGNKCILGRGDSKNQCVTGEGTPKPQSHNQGDFEPIPEDAYDE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 TYR n 1 4 THR n 1 5 ASP n 1 6 CYS n 1 7 THR n 1 8 GLU n 1 9 SER n 1 10 GLY n 1 11 GLN n 1 12 ASN n 1 13 LEU n 1 14 CYS n 1 15 LEU n 1 16 CYS n 1 17 GLU n 1 18 GLY n 1 19 SER n 1 20 ASN n 1 21 VAL n 1 22 CYS n 1 23 GLY n 1 24 GLN n 1 25 GLY n 1 26 ASN n 1 27 LYS n 1 28 CYS n 1 29 ILE n 1 30 LEU n 1 31 GLY n 1 32 ARG n 1 33 GLY n 1 34 ASP n 1 35 SER n 1 36 LYS n 1 37 ASN n 1 38 GLN n 1 39 CYS n 1 40 VAL n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 THR n 1 46 PRO n 1 47 LYS n 1 48 PRO n 1 49 GLN n 1 50 SER n 1 51 HIS n 1 52 ASN n 1 53 GLN n 1 54 GLY n 1 55 ASP n 1 56 PHE n 1 57 GLU n 1 58 PRO n 1 59 ILE n 1 60 PRO n 1 61 GLU n 1 62 ASP n 1 63 ALA n 1 64 TYR n 1 65 ASP n 1 66 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'medicinal leech' _entity_src_gen.gene_src_genus Hirudo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hirudo medicinalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus Pichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ASN 52 52 ? ? ? A . n A 1 53 GLN 53 53 ? ? ? A . n A 1 54 GLY 54 54 ? ? ? A . n A 1 55 ASP 55 55 ? ? ? A . n A 1 56 PHE 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 PRO 58 58 ? ? ? A . n A 1 59 ILE 59 59 ? ? ? A . n A 1 60 PRO 60 60 ? ? ? A . n A 1 61 GLU 61 61 ? ? ? A . n A 1 62 ASP 62 62 ? ? ? A . n A 1 63 ALA 63 63 ? ? ? A . n A 1 64 TYR 64 64 ? ? ? A . n A 1 65 ASP 65 65 ? ? ? A . n A 1 66 GLU 66 66 ? ? ? A . n # _cell.entry_id 2JOO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JOO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JOO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JOO _struct.title 'The NMR Solution Structure of Recombinant RGD-hirudin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JOO _struct_keywords.pdbx_keywords 'BLOOD CLOTTING' _struct_keywords.text 'Mainly Beta, BLOOD CLOTTING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITH1_HIRME _struct_ref.pdbx_db_accession P01050 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JOO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01050 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JOO ARG A 32 ? UNP P01050 SER 32 'engineered mutation' 32 1 1 2JOO GLY A 33 ? UNP P01050 ASP 33 'engineered mutation' 33 2 1 2JOO ASP A 34 ? UNP P01050 GLY 34 'engineered mutation' 34 3 1 2JOO SER A 35 ? UNP P01050 GLU 35 'engineered mutation' 35 4 1 2JOO GLN A 53 ? UNP P01050 ASP 53 'engineered mutation' 53 5 1 2JOO PRO A 58 ? UNP P01050 GLU 58 'engineered mutation' 58 6 1 2JOO ASP A 62 ? UNP P01050 GLU 62 'engineered mutation' 62 7 1 2JOO ALA A 63 ? UNP P01050 TYR 63 'engineered mutation' 63 8 1 2JOO TYR A 64 ? UNP P01050 LEU 64 'engineered mutation' 64 9 1 2JOO ASP A 65 ? UNP P01050 GLN 65 'engineered mutation' 65 10 1 2JOO GLU A 66 ? UNP P01050 ? ? 'expression tag' 66 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 6 A CYS 14 1_555 ? ? ? ? ? ? ? 2.877 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 16 A CYS 28 1_555 ? ? ? ? ? ? ? 2.834 ? ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 22 A CYS 39 1_555 ? ? ? ? ? ? ? 2.826 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 6 ? CYS A 14 ? CYS A 6 ? 1_555 CYS A 14 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 16 ? CYS A 28 ? CYS A 16 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 22 ? CYS A 39 ? CYS A 22 ? 1_555 CYS A 39 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 26 ? ILE A 29 ? ASN A 26 ILE A 29 A 2 GLN A 38 ? THR A 41 ? GLN A 38 THR A 41 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 40 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 40 # _pdbx_entry_details.entry_id 2JOO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE21 A GLN 11 ? ? HG3 A LYS 47 ? ? 1.21 2 3 O A ASN 12 ? ? H A CYS 14 ? ? 1.59 3 4 O A ASP 5 ? ? HZ3 A LYS 47 ? ? 1.59 4 4 O A ASN 12 ? ? H A CYS 14 ? ? 1.59 5 6 O A GLU 17 ? ? H A ASN 20 ? ? 1.54 6 6 H A GLY 10 ? ? O A CYS 28 ? ? 1.60 7 9 O A GLU 17 ? ? H A ASN 20 ? ? 1.57 8 14 O A ASN 12 ? ? H A CYS 14 ? ? 1.58 9 16 HG3 A GLN 11 ? ? HG22 A THR 45 ? ? 1.32 10 16 O A ASN 12 ? ? H A CYS 14 ? ? 1.57 11 19 HG A CYS 16 ? ? OD1 A ASN 37 ? ? 1.57 12 19 O A ASN 12 ? ? H A CYS 14 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 12 ? ? -127.61 -59.26 2 1 LEU A 13 ? ? -60.64 59.50 3 1 CYS A 16 ? ? -86.56 -72.87 4 1 SER A 35 ? ? -99.58 53.55 5 1 GLN A 49 ? ? -151.47 -28.18 6 2 THR A 4 ? ? -121.91 -159.33 7 2 ASN A 12 ? ? -129.23 -60.02 8 2 LEU A 13 ? ? -59.66 60.65 9 2 CYS A 16 ? ? -98.12 -79.42 10 2 ARG A 32 ? ? -154.09 79.82 11 2 GLN A 49 ? ? -164.07 -55.66 12 3 ASN A 12 ? ? -134.31 -57.38 13 3 LEU A 13 ? ? -63.26 59.20 14 3 CYS A 16 ? ? -74.16 -77.83 15 3 ASN A 37 ? ? -153.87 80.08 16 3 GLN A 49 ? ? -139.02 -38.59 17 4 VAL A 2 ? ? -100.04 76.03 18 4 ASN A 12 ? ? -135.62 -58.19 19 4 LEU A 13 ? ? -61.75 60.56 20 4 CYS A 16 ? ? -82.34 -74.93 21 5 ASN A 12 ? ? -126.79 -61.85 22 5 LEU A 13 ? ? -58.99 63.04 23 5 CYS A 16 ? ? -61.30 -77.55 24 5 ASN A 37 ? ? -153.41 82.28 25 5 GLN A 49 ? ? -133.38 -33.87 26 6 ASN A 12 ? ? -134.93 -58.00 27 6 LEU A 13 ? ? -58.16 61.81 28 6 CYS A 16 ? ? -73.79 -74.49 29 6 SER A 35 ? ? -90.73 30.65 30 7 THR A 4 ? ? -125.40 -167.89 31 7 ASN A 12 ? ? -159.04 -55.20 32 7 LEU A 13 ? ? -60.80 61.34 33 7 CYS A 16 ? ? -92.65 -65.04 34 7 SER A 35 ? ? -91.64 37.29 35 7 ASN A 37 ? ? -155.10 75.28 36 7 SER A 50 ? ? -102.98 -92.57 37 8 VAL A 2 ? ? -112.62 79.89 38 8 THR A 4 ? ? -134.91 -159.88 39 8 ASN A 12 ? ? -136.77 -57.12 40 8 LEU A 13 ? ? -59.55 61.39 41 8 CYS A 16 ? ? -94.57 -70.85 42 8 ARG A 32 ? ? -169.26 114.46 43 8 ASP A 34 ? ? -98.43 48.75 44 8 ASN A 37 ? ? -154.70 81.71 45 9 ASN A 12 ? ? -132.74 -59.24 46 9 LEU A 13 ? ? -60.29 61.47 47 9 CYS A 16 ? ? -60.66 -70.72 48 9 LYS A 36 ? ? -135.37 -32.50 49 9 ASN A 37 ? ? -155.64 77.70 50 9 GLN A 49 ? ? -150.25 -66.23 51 10 ASN A 12 ? ? -133.79 -57.28 52 10 LEU A 13 ? ? -61.47 60.58 53 10 CYS A 16 ? ? -66.28 -73.17 54 10 LYS A 36 ? ? -132.71 -38.21 55 10 GLN A 49 ? ? -160.94 -69.86 56 10 SER A 50 ? ? -112.60 63.19 57 11 THR A 4 ? ? -151.32 -157.54 58 11 ASN A 12 ? ? -135.66 -56.17 59 11 LEU A 13 ? ? -62.15 63.13 60 11 CYS A 16 ? ? -67.87 -79.87 61 11 SER A 35 ? ? -104.88 47.44 62 11 GLN A 49 ? ? -148.59 -10.77 63 11 SER A 50 ? ? -151.51 35.17 64 12 ASN A 12 ? ? -143.52 -55.81 65 12 LEU A 13 ? ? -61.61 66.04 66 12 CYS A 16 ? ? -72.77 -80.21 67 12 GLN A 49 ? ? -156.97 -33.02 68 13 ASN A 12 ? ? -136.04 -56.74 69 13 LEU A 13 ? ? -61.83 62.18 70 13 CYS A 16 ? ? -98.73 -65.90 71 13 SER A 35 ? ? -93.62 31.86 72 13 ASN A 37 ? ? -154.93 89.80 73 13 GLN A 49 ? ? -142.95 -42.23 74 14 ASN A 12 ? ? -139.74 -57.05 75 14 LEU A 13 ? ? -62.10 59.43 76 14 CYS A 16 ? ? -62.66 -73.51 77 14 GLN A 49 ? ? -133.35 -36.41 78 15 ASN A 12 ? ? -145.45 -56.73 79 15 LEU A 13 ? ? -62.67 58.73 80 15 CYS A 16 ? ? -89.44 -70.48 81 15 ASN A 37 ? ? -153.82 77.15 82 15 GLN A 49 ? ? -176.33 -18.64 83 16 ASN A 12 ? ? -136.05 -55.93 84 16 LEU A 13 ? ? -61.07 55.89 85 16 CYS A 16 ? ? -72.65 -77.31 86 17 ASN A 12 ? ? -142.41 -57.44 87 17 LEU A 13 ? ? -62.87 61.62 88 17 ARG A 32 ? ? 73.33 153.79 89 17 LYS A 36 ? ? -139.66 -33.47 90 17 GLN A 49 ? ? -155.03 -44.01 91 18 ASN A 12 ? ? -140.15 -55.24 92 18 LEU A 13 ? ? -62.76 56.24 93 18 CYS A 16 ? ? -89.47 -71.34 94 18 SER A 35 ? ? -94.38 30.58 95 19 ASN A 12 ? ? -143.47 -57.29 96 19 LEU A 13 ? ? -62.35 56.62 97 19 CYS A 16 ? ? -57.20 -78.04 98 19 GLN A 49 ? ? -168.89 -54.96 99 19 SER A 50 ? ? -146.25 -57.83 100 20 ASN A 12 ? ? -148.81 -54.14 101 20 LEU A 13 ? ? -60.55 65.95 102 20 CYS A 16 ? ? -74.85 -78.48 103 20 SER A 35 ? ? -94.58 30.11 104 20 GLN A 49 ? ? -132.46 -37.29 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'closest to the average' _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JOO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JOO _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '5 mM RGD-hirudin, 0.02mol/L Na2HPO4/NaH2PO4 buffer, pH 7.0, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component RGD-hirudin _pdbx_nmr_exptl_sample.concentration 5 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H COSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D DQF-COSY' # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 2JOO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors ;Linge, O'Donoghue and Nilges ; _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name ARIA _pdbx_nmr_software.version 2.0 _pdbx_nmr_software.ordinal 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 52 ? A ASN 52 2 1 Y 1 A GLN 53 ? A GLN 53 3 1 Y 1 A GLY 54 ? A GLY 54 4 1 Y 1 A ASP 55 ? A ASP 55 5 1 Y 1 A PHE 56 ? A PHE 56 6 1 Y 1 A GLU 57 ? A GLU 57 7 1 Y 1 A PRO 58 ? A PRO 58 8 1 Y 1 A ILE 59 ? A ILE 59 9 1 Y 1 A PRO 60 ? A PRO 60 10 1 Y 1 A GLU 61 ? A GLU 61 11 1 Y 1 A ASP 62 ? A ASP 62 12 1 Y 1 A ALA 63 ? A ALA 63 13 1 Y 1 A TYR 64 ? A TYR 64 14 1 Y 1 A ASP 65 ? A ASP 65 15 1 Y 1 A GLU 66 ? A GLU 66 16 2 Y 1 A ASN 52 ? A ASN 52 17 2 Y 1 A GLN 53 ? A GLN 53 18 2 Y 1 A GLY 54 ? A GLY 54 19 2 Y 1 A ASP 55 ? A ASP 55 20 2 Y 1 A PHE 56 ? A PHE 56 21 2 Y 1 A GLU 57 ? A GLU 57 22 2 Y 1 A PRO 58 ? A PRO 58 23 2 Y 1 A ILE 59 ? A ILE 59 24 2 Y 1 A PRO 60 ? A PRO 60 25 2 Y 1 A GLU 61 ? A GLU 61 26 2 Y 1 A ASP 62 ? A ASP 62 27 2 Y 1 A ALA 63 ? A ALA 63 28 2 Y 1 A TYR 64 ? A TYR 64 29 2 Y 1 A ASP 65 ? A ASP 65 30 2 Y 1 A GLU 66 ? A GLU 66 31 3 Y 1 A ASN 52 ? A ASN 52 32 3 Y 1 A GLN 53 ? A GLN 53 33 3 Y 1 A GLY 54 ? A GLY 54 34 3 Y 1 A ASP 55 ? A ASP 55 35 3 Y 1 A PHE 56 ? A PHE 56 36 3 Y 1 A GLU 57 ? A GLU 57 37 3 Y 1 A PRO 58 ? A PRO 58 38 3 Y 1 A ILE 59 ? A ILE 59 39 3 Y 1 A PRO 60 ? A PRO 60 40 3 Y 1 A GLU 61 ? A GLU 61 41 3 Y 1 A ASP 62 ? A ASP 62 42 3 Y 1 A ALA 63 ? A ALA 63 43 3 Y 1 A TYR 64 ? A TYR 64 44 3 Y 1 A ASP 65 ? A ASP 65 45 3 Y 1 A GLU 66 ? A GLU 66 46 4 Y 1 A ASN 52 ? A ASN 52 47 4 Y 1 A GLN 53 ? A GLN 53 48 4 Y 1 A GLY 54 ? A GLY 54 49 4 Y 1 A ASP 55 ? A ASP 55 50 4 Y 1 A PHE 56 ? A PHE 56 51 4 Y 1 A GLU 57 ? A GLU 57 52 4 Y 1 A PRO 58 ? A PRO 58 53 4 Y 1 A ILE 59 ? A ILE 59 54 4 Y 1 A PRO 60 ? A PRO 60 55 4 Y 1 A GLU 61 ? A GLU 61 56 4 Y 1 A ASP 62 ? A ASP 62 57 4 Y 1 A ALA 63 ? A ALA 63 58 4 Y 1 A TYR 64 ? A TYR 64 59 4 Y 1 A ASP 65 ? A ASP 65 60 4 Y 1 A GLU 66 ? A GLU 66 61 5 Y 1 A ASN 52 ? A ASN 52 62 5 Y 1 A GLN 53 ? A GLN 53 63 5 Y 1 A GLY 54 ? A GLY 54 64 5 Y 1 A ASP 55 ? A ASP 55 65 5 Y 1 A PHE 56 ? A PHE 56 66 5 Y 1 A GLU 57 ? A GLU 57 67 5 Y 1 A PRO 58 ? A PRO 58 68 5 Y 1 A ILE 59 ? A ILE 59 69 5 Y 1 A PRO 60 ? A PRO 60 70 5 Y 1 A GLU 61 ? A GLU 61 71 5 Y 1 A ASP 62 ? A ASP 62 72 5 Y 1 A ALA 63 ? A ALA 63 73 5 Y 1 A TYR 64 ? A TYR 64 74 5 Y 1 A ASP 65 ? A ASP 65 75 5 Y 1 A GLU 66 ? A GLU 66 76 6 Y 1 A ASN 52 ? A ASN 52 77 6 Y 1 A GLN 53 ? A GLN 53 78 6 Y 1 A GLY 54 ? A GLY 54 79 6 Y 1 A ASP 55 ? A ASP 55 80 6 Y 1 A PHE 56 ? A PHE 56 81 6 Y 1 A GLU 57 ? A GLU 57 82 6 Y 1 A PRO 58 ? A PRO 58 83 6 Y 1 A ILE 59 ? A ILE 59 84 6 Y 1 A PRO 60 ? A PRO 60 85 6 Y 1 A GLU 61 ? A GLU 61 86 6 Y 1 A ASP 62 ? A ASP 62 87 6 Y 1 A ALA 63 ? A ALA 63 88 6 Y 1 A TYR 64 ? A TYR 64 89 6 Y 1 A ASP 65 ? A ASP 65 90 6 Y 1 A GLU 66 ? A GLU 66 91 7 Y 1 A ASN 52 ? A ASN 52 92 7 Y 1 A GLN 53 ? A GLN 53 93 7 Y 1 A GLY 54 ? A GLY 54 94 7 Y 1 A ASP 55 ? A ASP 55 95 7 Y 1 A PHE 56 ? A PHE 56 96 7 Y 1 A GLU 57 ? A GLU 57 97 7 Y 1 A PRO 58 ? A PRO 58 98 7 Y 1 A ILE 59 ? A ILE 59 99 7 Y 1 A PRO 60 ? A PRO 60 100 7 Y 1 A GLU 61 ? A GLU 61 101 7 Y 1 A ASP 62 ? A ASP 62 102 7 Y 1 A ALA 63 ? A ALA 63 103 7 Y 1 A TYR 64 ? A TYR 64 104 7 Y 1 A ASP 65 ? A ASP 65 105 7 Y 1 A GLU 66 ? A GLU 66 106 8 Y 1 A ASN 52 ? A ASN 52 107 8 Y 1 A GLN 53 ? A GLN 53 108 8 Y 1 A GLY 54 ? A GLY 54 109 8 Y 1 A ASP 55 ? A ASP 55 110 8 Y 1 A PHE 56 ? A PHE 56 111 8 Y 1 A GLU 57 ? A GLU 57 112 8 Y 1 A PRO 58 ? A PRO 58 113 8 Y 1 A ILE 59 ? A ILE 59 114 8 Y 1 A PRO 60 ? A PRO 60 115 8 Y 1 A GLU 61 ? A GLU 61 116 8 Y 1 A ASP 62 ? A ASP 62 117 8 Y 1 A ALA 63 ? A ALA 63 118 8 Y 1 A TYR 64 ? A TYR 64 119 8 Y 1 A ASP 65 ? A ASP 65 120 8 Y 1 A GLU 66 ? A GLU 66 121 9 Y 1 A ASN 52 ? A ASN 52 122 9 Y 1 A GLN 53 ? A GLN 53 123 9 Y 1 A GLY 54 ? A GLY 54 124 9 Y 1 A ASP 55 ? A ASP 55 125 9 Y 1 A PHE 56 ? A PHE 56 126 9 Y 1 A GLU 57 ? A GLU 57 127 9 Y 1 A PRO 58 ? A PRO 58 128 9 Y 1 A ILE 59 ? A ILE 59 129 9 Y 1 A PRO 60 ? A PRO 60 130 9 Y 1 A GLU 61 ? A GLU 61 131 9 Y 1 A ASP 62 ? A ASP 62 132 9 Y 1 A ALA 63 ? A ALA 63 133 9 Y 1 A TYR 64 ? A TYR 64 134 9 Y 1 A ASP 65 ? A ASP 65 135 9 Y 1 A GLU 66 ? A GLU 66 136 10 Y 1 A ASN 52 ? A ASN 52 137 10 Y 1 A GLN 53 ? A GLN 53 138 10 Y 1 A GLY 54 ? A GLY 54 139 10 Y 1 A ASP 55 ? A ASP 55 140 10 Y 1 A PHE 56 ? A PHE 56 141 10 Y 1 A GLU 57 ? A GLU 57 142 10 Y 1 A PRO 58 ? A PRO 58 143 10 Y 1 A ILE 59 ? A ILE 59 144 10 Y 1 A PRO 60 ? A PRO 60 145 10 Y 1 A GLU 61 ? A GLU 61 146 10 Y 1 A ASP 62 ? A ASP 62 147 10 Y 1 A ALA 63 ? A ALA 63 148 10 Y 1 A TYR 64 ? A TYR 64 149 10 Y 1 A ASP 65 ? A ASP 65 150 10 Y 1 A GLU 66 ? A GLU 66 151 11 Y 1 A ASN 52 ? A ASN 52 152 11 Y 1 A GLN 53 ? A GLN 53 153 11 Y 1 A GLY 54 ? A GLY 54 154 11 Y 1 A ASP 55 ? A ASP 55 155 11 Y 1 A PHE 56 ? A PHE 56 156 11 Y 1 A GLU 57 ? A GLU 57 157 11 Y 1 A PRO 58 ? A PRO 58 158 11 Y 1 A ILE 59 ? A ILE 59 159 11 Y 1 A PRO 60 ? A PRO 60 160 11 Y 1 A GLU 61 ? A GLU 61 161 11 Y 1 A ASP 62 ? A ASP 62 162 11 Y 1 A ALA 63 ? A ALA 63 163 11 Y 1 A TYR 64 ? A TYR 64 164 11 Y 1 A ASP 65 ? A ASP 65 165 11 Y 1 A GLU 66 ? A GLU 66 166 12 Y 1 A ASN 52 ? A ASN 52 167 12 Y 1 A GLN 53 ? A GLN 53 168 12 Y 1 A GLY 54 ? A GLY 54 169 12 Y 1 A ASP 55 ? A ASP 55 170 12 Y 1 A PHE 56 ? A PHE 56 171 12 Y 1 A GLU 57 ? A GLU 57 172 12 Y 1 A PRO 58 ? A PRO 58 173 12 Y 1 A ILE 59 ? A ILE 59 174 12 Y 1 A PRO 60 ? A PRO 60 175 12 Y 1 A GLU 61 ? A GLU 61 176 12 Y 1 A ASP 62 ? A ASP 62 177 12 Y 1 A ALA 63 ? A ALA 63 178 12 Y 1 A TYR 64 ? A TYR 64 179 12 Y 1 A ASP 65 ? A ASP 65 180 12 Y 1 A GLU 66 ? A GLU 66 181 13 Y 1 A ASN 52 ? A ASN 52 182 13 Y 1 A GLN 53 ? A GLN 53 183 13 Y 1 A GLY 54 ? A GLY 54 184 13 Y 1 A ASP 55 ? A ASP 55 185 13 Y 1 A PHE 56 ? A PHE 56 186 13 Y 1 A GLU 57 ? A GLU 57 187 13 Y 1 A PRO 58 ? A PRO 58 188 13 Y 1 A ILE 59 ? A ILE 59 189 13 Y 1 A PRO 60 ? A PRO 60 190 13 Y 1 A GLU 61 ? A GLU 61 191 13 Y 1 A ASP 62 ? A ASP 62 192 13 Y 1 A ALA 63 ? A ALA 63 193 13 Y 1 A TYR 64 ? A TYR 64 194 13 Y 1 A ASP 65 ? A ASP 65 195 13 Y 1 A GLU 66 ? A GLU 66 196 14 Y 1 A ASN 52 ? A ASN 52 197 14 Y 1 A GLN 53 ? A GLN 53 198 14 Y 1 A GLY 54 ? A GLY 54 199 14 Y 1 A ASP 55 ? A ASP 55 200 14 Y 1 A PHE 56 ? A PHE 56 201 14 Y 1 A GLU 57 ? A GLU 57 202 14 Y 1 A PRO 58 ? A PRO 58 203 14 Y 1 A ILE 59 ? A ILE 59 204 14 Y 1 A PRO 60 ? A PRO 60 205 14 Y 1 A GLU 61 ? A GLU 61 206 14 Y 1 A ASP 62 ? A ASP 62 207 14 Y 1 A ALA 63 ? A ALA 63 208 14 Y 1 A TYR 64 ? A TYR 64 209 14 Y 1 A ASP 65 ? A ASP 65 210 14 Y 1 A GLU 66 ? A GLU 66 211 15 Y 1 A ASN 52 ? A ASN 52 212 15 Y 1 A GLN 53 ? A GLN 53 213 15 Y 1 A GLY 54 ? A GLY 54 214 15 Y 1 A ASP 55 ? A ASP 55 215 15 Y 1 A PHE 56 ? A PHE 56 216 15 Y 1 A GLU 57 ? A GLU 57 217 15 Y 1 A PRO 58 ? A PRO 58 218 15 Y 1 A ILE 59 ? A ILE 59 219 15 Y 1 A PRO 60 ? A PRO 60 220 15 Y 1 A GLU 61 ? A GLU 61 221 15 Y 1 A ASP 62 ? A ASP 62 222 15 Y 1 A ALA 63 ? A ALA 63 223 15 Y 1 A TYR 64 ? A TYR 64 224 15 Y 1 A ASP 65 ? A ASP 65 225 15 Y 1 A GLU 66 ? A GLU 66 226 16 Y 1 A ASN 52 ? A ASN 52 227 16 Y 1 A GLN 53 ? A GLN 53 228 16 Y 1 A GLY 54 ? A GLY 54 229 16 Y 1 A ASP 55 ? A ASP 55 230 16 Y 1 A PHE 56 ? A PHE 56 231 16 Y 1 A GLU 57 ? A GLU 57 232 16 Y 1 A PRO 58 ? A PRO 58 233 16 Y 1 A ILE 59 ? A ILE 59 234 16 Y 1 A PRO 60 ? A PRO 60 235 16 Y 1 A GLU 61 ? A GLU 61 236 16 Y 1 A ASP 62 ? A ASP 62 237 16 Y 1 A ALA 63 ? A ALA 63 238 16 Y 1 A TYR 64 ? A TYR 64 239 16 Y 1 A ASP 65 ? A ASP 65 240 16 Y 1 A GLU 66 ? A GLU 66 241 17 Y 1 A ASN 52 ? A ASN 52 242 17 Y 1 A GLN 53 ? A GLN 53 243 17 Y 1 A GLY 54 ? A GLY 54 244 17 Y 1 A ASP 55 ? A ASP 55 245 17 Y 1 A PHE 56 ? A PHE 56 246 17 Y 1 A GLU 57 ? A GLU 57 247 17 Y 1 A PRO 58 ? A PRO 58 248 17 Y 1 A ILE 59 ? A ILE 59 249 17 Y 1 A PRO 60 ? A PRO 60 250 17 Y 1 A GLU 61 ? A GLU 61 251 17 Y 1 A ASP 62 ? A ASP 62 252 17 Y 1 A ALA 63 ? A ALA 63 253 17 Y 1 A TYR 64 ? A TYR 64 254 17 Y 1 A ASP 65 ? A ASP 65 255 17 Y 1 A GLU 66 ? A GLU 66 256 18 Y 1 A ASN 52 ? A ASN 52 257 18 Y 1 A GLN 53 ? A GLN 53 258 18 Y 1 A GLY 54 ? A GLY 54 259 18 Y 1 A ASP 55 ? A ASP 55 260 18 Y 1 A PHE 56 ? A PHE 56 261 18 Y 1 A GLU 57 ? A GLU 57 262 18 Y 1 A PRO 58 ? A PRO 58 263 18 Y 1 A ILE 59 ? A ILE 59 264 18 Y 1 A PRO 60 ? A PRO 60 265 18 Y 1 A GLU 61 ? A GLU 61 266 18 Y 1 A ASP 62 ? A ASP 62 267 18 Y 1 A ALA 63 ? A ALA 63 268 18 Y 1 A TYR 64 ? A TYR 64 269 18 Y 1 A ASP 65 ? A ASP 65 270 18 Y 1 A GLU 66 ? A GLU 66 271 19 Y 1 A ASN 52 ? A ASN 52 272 19 Y 1 A GLN 53 ? A GLN 53 273 19 Y 1 A GLY 54 ? A GLY 54 274 19 Y 1 A ASP 55 ? A ASP 55 275 19 Y 1 A PHE 56 ? A PHE 56 276 19 Y 1 A GLU 57 ? A GLU 57 277 19 Y 1 A PRO 58 ? A PRO 58 278 19 Y 1 A ILE 59 ? A ILE 59 279 19 Y 1 A PRO 60 ? A PRO 60 280 19 Y 1 A GLU 61 ? A GLU 61 281 19 Y 1 A ASP 62 ? A ASP 62 282 19 Y 1 A ALA 63 ? A ALA 63 283 19 Y 1 A TYR 64 ? A TYR 64 284 19 Y 1 A ASP 65 ? A ASP 65 285 19 Y 1 A GLU 66 ? A GLU 66 286 20 Y 1 A ASN 52 ? A ASN 52 287 20 Y 1 A GLN 53 ? A GLN 53 288 20 Y 1 A GLY 54 ? A GLY 54 289 20 Y 1 A ASP 55 ? A ASP 55 290 20 Y 1 A PHE 56 ? A PHE 56 291 20 Y 1 A GLU 57 ? A GLU 57 292 20 Y 1 A PRO 58 ? A PRO 58 293 20 Y 1 A ILE 59 ? A ILE 59 294 20 Y 1 A PRO 60 ? A PRO 60 295 20 Y 1 A GLU 61 ? A GLU 61 296 20 Y 1 A ASP 62 ? A ASP 62 297 20 Y 1 A ALA 63 ? A ALA 63 298 20 Y 1 A TYR 64 ? A TYR 64 299 20 Y 1 A ASP 65 ? A ASP 65 300 20 Y 1 A GLU 66 ? A GLU 66 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _atom_sites.entry_id 2JOO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_