data_2JOY # _entry.id 2JOY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JOY pdb_00002joy 10.2210/pdb2joy/pdb RCSB RCSB100106 ? ? WWPDB D_1000100106 ? ? BMRB 15210 ? 10.13018/BMR15210 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-15 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-05 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2023-12-20 7 'Structure model' 1 6 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Experimental preparation' 7 4 'Structure model' Other 8 5 'Structure model' 'Database references' 9 5 'Structure model' Other 10 6 'Structure model' 'Data collection' 11 6 'Structure model' Other 12 7 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_sample_details 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_struct_assembly 6 4 'Structure model' pdbx_struct_oper_list 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_database_status 9 6 'Structure model' chem_comp_atom 10 6 'Structure model' chem_comp_bond 11 6 'Structure model' pdbx_database_status 12 7 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_sample_details.contents' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 6 'Structure model' '_pdbx_database_status.deposit_site' 8 7 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JOY _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-04-10 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 15210 . unspecified TargetDB SsR105 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Singarapu, K.K.' 1 'Wu, Y.' 2 'Yee, A.' 3 'Semesi, A.' 4 'Arrowsmith, C.' 5 'Szyperski, T.' 6 'Northeast Structural Genomics Consortium (NESG)' 7 # _citation.id primary _citation.title 'NMR Structure of 50S Ribosomal Protein L14e; Northeast Structural Genomics Consortium Target SSR105' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Singarapu, K.K.' 1 ? primary 'Wu, Y.' 2 ? primary 'Yee, A.' 3 ? primary 'Semesi, A.' 4 ? primary 'Arrowsmith, C.' 5 ? primary 'Szyperski, T.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '50S ribosomal protein L14e' _entity.formula_weight 10881.885 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESN LTEYMKEKIKIRMPTL ; _entity_poly.pdbx_seq_one_letter_code_can ;MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESN LTEYMKEKIKIRMPTL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SsR105 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 ALA n 1 4 ILE n 1 5 GLU n 1 6 VAL n 1 7 GLY n 1 8 ARG n 1 9 ILE n 1 10 CYS n 1 11 VAL n 1 12 LYS n 1 13 VAL n 1 14 LYS n 1 15 GLY n 1 16 ARG n 1 17 GLU n 1 18 ALA n 1 19 GLY n 1 20 SER n 1 21 LYS n 1 22 CYS n 1 23 VAL n 1 24 ILE n 1 25 VAL n 1 26 ASP n 1 27 ILE n 1 28 ILE n 1 29 ASP n 1 30 ASP n 1 31 ASN n 1 32 PHE n 1 33 VAL n 1 34 LEU n 1 35 VAL n 1 36 THR n 1 37 GLY n 1 38 PRO n 1 39 LYS n 1 40 ASP n 1 41 ILE n 1 42 THR n 1 43 GLY n 1 44 VAL n 1 45 LYS n 1 46 ARG n 1 47 ARG n 1 48 ARG n 1 49 VAL n 1 50 ASN n 1 51 ILE n 1 52 LEU n 1 53 HIS n 1 54 LEU n 1 55 GLU n 1 56 PRO n 1 57 THR n 1 58 ASP n 1 59 LYS n 1 60 LYS n 1 61 ILE n 1 62 ASP n 1 63 ILE n 1 64 GLN n 1 65 LYS n 1 66 GLY n 1 67 ALA n 1 68 SER n 1 69 ASP n 1 70 GLU n 1 71 GLU n 1 72 VAL n 1 73 LYS n 1 74 LYS n 1 75 LYS n 1 76 LEU n 1 77 GLU n 1 78 GLU n 1 79 SER n 1 80 ASN n 1 81 LEU n 1 82 THR n 1 83 GLU n 1 84 TYR n 1 85 MET n 1 86 LYS n 1 87 GLU n 1 88 LYS n 1 89 ILE n 1 90 LYS n 1 91 ILE n 1 92 ARG n 1 93 MET n 1 94 PRO n 1 95 THR n 1 96 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Sulfolobus _entity_src_gen.pdbx_gene_src_gene rpl14e _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus solfataricus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector p11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LEU 96 96 96 LEU LEU A . n # _cell.entry_id 2JOY _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JOY _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JOY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JOY _struct.title 'NMR Structure of 50S Ribosomal Protein L14e from Sulfolobus Solfataricus: Northeast Structural Genomics Consortium Target SSR105' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JOY _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;50s ribosomal protein l14e, protein nmr, solution structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RL14E_SULSO _struct_ref.pdbx_db_accession Q980C1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESN LTEYMKEKIKIRMPTL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JOY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q980C1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 96 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 68 ? SER A 79 ? SER A 68 SER A 79 1 ? 12 HELX_P HELX_P2 2 LEU A 81 ? GLU A 87 ? LEU A 81 GLU A 87 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 47 ? VAL A 49 ? ARG A 47 VAL A 49 A 2 VAL A 33 ? THR A 36 ? VAL A 33 THR A 36 A 3 LYS A 21 ? ILE A 27 ? LYS A 21 ILE A 27 A 4 ARG A 8 ? VAL A 11 ? ARG A 8 VAL A 11 A 5 GLU A 55 ? LYS A 60 ? GLU A 55 LYS A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 49 ? O VAL A 49 N VAL A 33 ? N VAL A 33 A 2 3 O THR A 36 ? O THR A 36 N VAL A 23 ? N VAL A 23 A 3 4 O CYS A 22 ? O CYS A 22 N CYS A 10 ? N CYS A 10 A 4 5 N ILE A 9 ? N ILE A 9 O THR A 57 ? O THR A 57 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 71 ? ? HZ2 A LYS 75 ? ? 1.55 2 1 OD2 A ASP 40 ? ? HZ2 A LYS 73 ? ? 1.58 3 2 HZ3 A LYS 12 ? ? OE1 A GLU 17 ? ? 1.57 4 2 OD1 A ASP 58 ? ? HZ1 A LYS 59 ? ? 1.60 5 4 HZ1 A LYS 75 ? ? OE1 A GLU 78 ? ? 1.59 6 5 OE1 A GLU 71 ? ? HZ3 A LYS 74 ? ? 1.57 7 5 HZ2 A LYS 14 ? ? OE2 A GLU 17 ? ? 1.60 8 7 HZ3 A LYS 73 ? ? OE1 A GLU 77 ? ? 1.58 9 7 OE2 A GLU 71 ? ? HZ1 A LYS 75 ? ? 1.60 10 9 OD1 A ASP 69 ? ? HZ1 A LYS 73 ? ? 1.60 11 10 OE1 A GLU 5 ? ? HZ3 A LYS 60 ? ? 1.55 12 10 HZ2 A LYS 39 ? ? OD1 A ASP 69 ? ? 1.58 13 10 OE1 A GLU 70 ? ? HZ2 A LYS 73 ? ? 1.60 14 11 OD2 A ASP 58 ? ? HZ3 A LYS 59 ? ? 1.59 15 11 OE2 A GLU 71 ? ? HZ1 A LYS 75 ? ? 1.60 16 12 HZ3 A LYS 12 ? ? OE1 A GLU 55 ? ? 1.59 17 12 OE1 A GLU 71 ? ? HZ1 A LYS 75 ? ? 1.60 18 13 OD2 A ASP 58 ? ? HZ1 A LYS 59 ? ? 1.59 19 15 OD2 A ASP 40 ? ? HZ1 A LYS 73 ? ? 1.58 20 15 OE2 A GLU 5 ? ? HZ2 A LYS 60 ? ? 1.59 21 16 OE1 A GLU 5 ? ? HZ2 A LYS 60 ? ? 1.54 22 16 HZ1 A LYS 39 ? ? OD2 A ASP 40 ? ? 1.58 23 16 OE1 A GLU 71 ? ? HZ3 A LYS 75 ? ? 1.59 24 16 HZ2 A LYS 74 ? ? OE1 A GLU 78 ? ? 1.59 25 16 OE2 A GLU 70 ? ? HZ1 A LYS 73 ? ? 1.60 26 17 OD1 A ASP 40 ? ? HZ2 A LYS 73 ? ? 1.55 27 17 OD1 A ASP 26 ? ? HZ3 A LYS 65 ? ? 1.57 28 17 OD1 A ASP 29 ? ? HH12 A ARG 48 ? ? 1.59 29 20 OE2 A GLU 70 ? ? HZ1 A LYS 73 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -59.01 103.93 2 1 ALA A 3 ? ? -164.40 112.01 3 1 ARG A 16 ? ? -157.34 55.69 4 1 GLU A 17 ? ? 66.54 -83.39 5 1 ALA A 18 ? ? -162.91 36.01 6 1 ASP A 29 ? ? -160.50 -163.62 7 1 ILE A 51 ? ? 56.16 82.03 8 1 HIS A 53 ? ? -158.31 74.51 9 1 ILE A 91 ? ? -91.55 33.47 10 2 ALA A 3 ? ? 71.57 -164.35 11 2 LYS A 14 ? ? 54.72 -83.44 12 2 ASP A 29 ? ? -133.33 -151.20 13 2 ILE A 41 ? ? -129.17 -79.39 14 2 HIS A 53 ? ? -147.69 44.68 15 2 ASP A 58 ? ? 63.45 -158.14 16 2 PRO A 94 ? ? -66.94 93.70 17 3 PRO A 2 ? ? -53.77 109.99 18 3 ALA A 3 ? ? -173.52 86.25 19 3 ILE A 4 ? ? 65.87 91.92 20 3 VAL A 13 ? ? -117.25 61.08 21 3 HIS A 53 ? ? -109.83 49.83 22 3 LYS A 90 ? ? 62.56 -163.24 23 4 ILE A 4 ? ? -102.55 76.44 24 4 ARG A 16 ? ? 66.30 -65.38 25 4 ASP A 40 ? ? 67.37 -57.43 26 4 ILE A 41 ? ? -88.95 -73.45 27 4 ILE A 63 ? ? -125.67 -169.45 28 4 LYS A 88 ? ? 72.32 -171.61 29 4 ARG A 92 ? ? 62.07 84.63 30 5 VAL A 13 ? ? -111.91 63.68 31 5 ILE A 28 ? ? -96.81 -63.89 32 5 ASP A 29 ? ? -107.56 -159.10 33 5 THR A 42 ? ? 71.70 86.06 34 5 LYS A 45 ? ? 66.72 -161.93 35 5 ASN A 50 ? ? 52.51 175.14 36 5 LYS A 88 ? ? -165.22 -165.13 37 6 GLU A 5 ? ? -176.37 -167.33 38 6 ARG A 16 ? ? -137.82 -76.87 39 6 ASP A 40 ? ? 77.42 -27.66 40 6 ARG A 47 ? ? -171.73 -178.89 41 6 LEU A 52 ? ? 72.40 -11.32 42 6 HIS A 53 ? ? 67.77 83.00 43 6 PRO A 94 ? ? -75.59 -154.58 44 7 ALA A 3 ? ? 70.52 172.19 45 7 ALA A 18 ? ? 63.58 -163.27 46 7 ASP A 29 ? ? -125.31 -167.49 47 7 PRO A 38 ? ? -30.87 111.89 48 7 ILE A 41 ? ? -102.75 -63.05 49 7 ASP A 58 ? ? -53.44 -74.58 50 7 LYS A 88 ? ? 59.21 92.07 51 7 MET A 93 ? ? 65.32 171.99 52 8 PRO A 2 ? ? -54.01 106.21 53 8 ILE A 4 ? ? 65.01 95.25 54 8 ARG A 16 ? ? 76.40 -37.07 55 8 PRO A 38 ? ? -67.01 95.95 56 8 ILE A 41 ? ? -120.48 -53.97 57 8 LEU A 52 ? ? -164.09 35.28 58 8 HIS A 53 ? ? -136.78 -37.09 59 8 LYS A 65 ? ? -55.39 109.72 60 8 ILE A 91 ? ? 71.58 79.91 61 9 ILE A 4 ? ? 60.78 85.79 62 9 LYS A 12 ? ? 50.99 174.58 63 9 VAL A 13 ? ? -120.47 -78.09 64 9 ARG A 16 ? ? 69.43 -74.15 65 9 ARG A 92 ? ? 70.43 -153.93 66 10 ILE A 4 ? ? 74.50 110.92 67 10 ARG A 16 ? ? 74.21 -5.49 68 10 ALA A 18 ? ? -76.04 36.46 69 10 ASP A 40 ? ? 76.05 -54.19 70 10 THR A 42 ? ? 72.87 -51.12 71 10 ASN A 50 ? ? 69.22 150.93 72 10 LEU A 52 ? ? -105.21 -74.01 73 10 HIS A 53 ? ? -118.95 51.27 74 10 LYS A 90 ? ? 67.11 176.55 75 10 THR A 95 ? ? 77.77 -11.69 76 11 ALA A 3 ? ? 70.31 177.92 77 11 ILE A 4 ? ? 38.99 60.76 78 11 VAL A 13 ? ? -103.51 46.48 79 11 ARG A 16 ? ? -169.34 -59.15 80 11 ILE A 41 ? ? -87.21 -75.14 81 11 PRO A 94 ? ? -59.82 97.96 82 12 LYS A 12 ? ? 48.83 173.30 83 12 VAL A 13 ? ? -133.12 -65.61 84 12 GLU A 17 ? ? 72.52 151.35 85 12 ALA A 18 ? ? 63.54 95.59 86 12 ILE A 28 ? ? -97.32 -71.40 87 12 ILE A 41 ? ? -98.94 -63.48 88 12 ASN A 50 ? ? 64.67 -175.97 89 12 LEU A 52 ? ? -80.05 34.69 90 12 LYS A 86 ? ? -86.72 37.40 91 13 ILE A 4 ? ? 52.48 82.06 92 13 LYS A 14 ? ? -82.56 42.67 93 13 ARG A 16 ? ? -178.53 -67.34 94 13 PRO A 38 ? ? -29.85 114.88 95 13 ILE A 41 ? ? -106.01 -70.10 96 13 LEU A 52 ? ? -76.98 30.45 97 13 ASP A 58 ? ? 55.90 -151.74 98 14 PRO A 2 ? ? -54.86 105.02 99 14 ILE A 4 ? ? 58.02 88.39 100 14 VAL A 13 ? ? -85.48 41.77 101 14 ARG A 16 ? ? -158.44 14.42 102 14 GLU A 17 ? ? -133.30 -70.03 103 14 ALA A 18 ? ? 70.42 130.01 104 14 THR A 95 ? ? 72.22 128.74 105 15 ILE A 4 ? ? 60.82 87.11 106 15 ASP A 29 ? ? -119.32 -165.25 107 15 LYS A 88 ? ? 59.45 85.80 108 16 ILE A 4 ? ? 69.02 96.91 109 16 VAL A 13 ? ? -119.60 62.30 110 16 ASP A 29 ? ? -110.24 -163.38 111 16 THR A 36 ? ? -172.09 -175.19 112 16 ILE A 41 ? ? -121.74 -63.18 113 16 MET A 93 ? ? 68.54 108.11 114 17 ARG A 16 ? ? 74.38 150.56 115 17 GLU A 17 ? ? -56.20 94.50 116 17 ILE A 28 ? ? -94.98 -65.91 117 17 PRO A 38 ? ? -36.45 123.97 118 17 ILE A 41 ? ? -122.08 -69.52 119 17 VAL A 44 ? ? -104.40 -95.37 120 17 LYS A 45 ? ? 174.80 179.05 121 17 ASP A 62 ? ? -86.09 46.57 122 17 LYS A 88 ? ? 71.19 113.80 123 18 ILE A 4 ? ? 58.29 76.47 124 18 ASP A 29 ? ? -108.11 -159.41 125 18 PRO A 38 ? ? -24.23 114.62 126 18 ILE A 41 ? ? -121.92 -53.90 127 18 ASN A 50 ? ? -88.45 31.00 128 18 ILE A 51 ? ? 59.10 91.47 129 18 LEU A 52 ? ? -173.61 -42.11 130 18 ASP A 62 ? ? 64.52 112.98 131 18 LYS A 88 ? ? 64.74 -165.12 132 18 ARG A 92 ? ? -98.70 58.92 133 18 PRO A 94 ? ? -68.25 92.00 134 19 ILE A 4 ? ? 70.05 96.93 135 19 LYS A 14 ? ? -55.40 99.77 136 19 ARG A 16 ? ? -161.37 26.05 137 19 ASP A 29 ? ? -128.97 -161.35 138 19 PRO A 38 ? ? -26.44 112.04 139 19 ILE A 41 ? ? -105.82 -74.79 140 19 LYS A 45 ? ? -62.61 97.59 141 19 ASP A 62 ? ? 66.36 97.79 142 20 ILE A 4 ? ? 68.53 111.29 143 20 ARG A 16 ? ? -130.89 -84.09 144 20 PRO A 38 ? ? -37.29 123.08 145 20 LYS A 45 ? ? 69.35 -178.66 146 20 ASN A 50 ? ? 59.32 178.09 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JOY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JOY _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '0.5 mM [U-100% 13C; U-100% 15N] entity, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity 0.5 mM '[U-100% 13C; U-100% 15N]' 1 entity 0.5 mM '[U-10% 13C; U-99% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 320 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '4,3 D GFT HCCH COFY' 1 8 1 '3D HCCH-COSY' 1 9 1 '3D Simultanious NOESY' # _pdbx_nmr_refine.details 'CNS waterbath refinement is performed to refine the structure' _pdbx_nmr_refine.entry_id 2JOY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VNMR ? 1 'Zimmerman, Moseley, Kulikowski, Montelione' 'data analysis' AutoAssign ? 2 'Huang, Swapna, Rajan, Ke, Xia, Shukla, Inouye and Montelione' refinement AutoStructure ? 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 4 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 6 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2JOY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_