data_2JPD # _entry.id 2JPD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JPD pdb_00002jpd 10.2210/pdb2jpd/pdb RCSB RCSB100121 ? ? WWPDB D_1000100121 ? ? BMRB 15240 ? 10.13018/BMR15240 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2023-12-20 6 'Structure model' 1 5 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other 7 4 'Structure model' 'Database references' 8 4 'Structure model' Other 9 5 'Structure model' 'Data collection' 10 5 'Structure model' Other 11 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_sample_details 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_assembly 7 3 'Structure model' pdbx_struct_oper_list 8 3 'Structure model' struct_ref_seq_dif 9 4 'Structure model' database_2 10 4 'Structure model' pdbx_database_status 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' pdbx_database_status 14 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' 8 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 9 5 'Structure model' '_pdbx_database_status.deposit_site' 10 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JPD _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-05-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15240 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tripsianes, K.' 1 'Folkers, G.' 2 'Zheng, C.' 3 'Das, D.' 4 'Grinstead, J.S.' 5 'Kaptein, R.' 6 'Boelens, R.' 7 # _citation.id primary _citation.title 'Analysis of the XPA and ssDNA-binding surfaces on the central domain of human ERCC1 reveals evidence for subfunctionalization' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 35 _citation.page_first 5789 _citation.page_last 5798 _citation.year 2007 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17720715 _citation.pdbx_database_id_DOI 10.1093/nar/gkm503 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tripsianes, K.' 1 ? primary 'Folkers, G.E.' 2 ? primary 'Zheng, C.' 3 ? primary 'Das, D.' 4 ? primary 'Grinstead, J.S.' 5 ? primary 'Kaptein, R.' 6 ? primary 'Boelens, R.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA excision repair protein ERCC-1' _entity.formula_weight 15461.830 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 96-219' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVD VKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPGGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVD VKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPGGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LYS n 1 4 SER n 1 5 ASN n 1 6 SER n 1 7 ILE n 1 8 ILE n 1 9 VAL n 1 10 SER n 1 11 PRO n 1 12 ARG n 1 13 GLN n 1 14 ARG n 1 15 GLY n 1 16 ASN n 1 17 PRO n 1 18 VAL n 1 19 LEU n 1 20 LYS n 1 21 PHE n 1 22 VAL n 1 23 ARG n 1 24 ASN n 1 25 VAL n 1 26 PRO n 1 27 TRP n 1 28 GLU n 1 29 PHE n 1 30 GLY n 1 31 ASP n 1 32 VAL n 1 33 ILE n 1 34 PRO n 1 35 ASP n 1 36 TYR n 1 37 VAL n 1 38 LEU n 1 39 GLY n 1 40 GLN n 1 41 SER n 1 42 THR n 1 43 CYS n 1 44 ALA n 1 45 LEU n 1 46 PHE n 1 47 LEU n 1 48 SER n 1 49 LEU n 1 50 ARG n 1 51 TYR n 1 52 HIS n 1 53 ASN n 1 54 LEU n 1 55 HIS n 1 56 PRO n 1 57 ASP n 1 58 TYR n 1 59 ILE n 1 60 HIS n 1 61 GLY n 1 62 ARG n 1 63 LEU n 1 64 GLN n 1 65 SER n 1 66 LEU n 1 67 GLY n 1 68 LYS n 1 69 ASN n 1 70 PHE n 1 71 ALA n 1 72 LEU n 1 73 ARG n 1 74 VAL n 1 75 LEU n 1 76 LEU n 1 77 VAL n 1 78 GLN n 1 79 VAL n 1 80 ASP n 1 81 VAL n 1 82 LYS n 1 83 ASP n 1 84 PRO n 1 85 GLN n 1 86 GLN n 1 87 ALA n 1 88 LEU n 1 89 LYS n 1 90 GLU n 1 91 LEU n 1 92 ALA n 1 93 LYS n 1 94 MET n 1 95 CYS n 1 96 ILE n 1 97 LEU n 1 98 ALA n 1 99 ASP n 1 100 CYS n 1 101 THR n 1 102 LEU n 1 103 ILE n 1 104 LEU n 1 105 ALA n 1 106 TRP n 1 107 SER n 1 108 PRO n 1 109 GLU n 1 110 GLU n 1 111 ALA n 1 112 GLY n 1 113 ARG n 1 114 TYR n 1 115 LEU n 1 116 GLU n 1 117 THR n 1 118 TYR n 1 119 LYS n 1 120 ALA n 1 121 TYR n 1 122 GLU n 1 123 GLN n 1 124 LYS n 1 125 PRO n 1 126 GLY n 1 127 GLY n 1 128 LEU n 1 129 GLU n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ERCC1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET28b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 95 ? ? ? A . n A 1 2 ALA 2 96 96 ALA ALA A . n A 1 3 LYS 3 97 97 LYS LYS A . n A 1 4 SER 4 98 98 SER SER A . n A 1 5 ASN 5 99 99 ASN ASN A . n A 1 6 SER 6 100 100 SER SER A . n A 1 7 ILE 7 101 101 ILE ILE A . n A 1 8 ILE 8 102 102 ILE ILE A . n A 1 9 VAL 9 103 103 VAL VAL A . n A 1 10 SER 10 104 104 SER SER A . n A 1 11 PRO 11 105 105 PRO PRO A . n A 1 12 ARG 12 106 106 ARG ARG A . n A 1 13 GLN 13 107 107 GLN GLN A . n A 1 14 ARG 14 108 108 ARG ARG A . n A 1 15 GLY 15 109 109 GLY GLY A . n A 1 16 ASN 16 110 110 ASN ASN A . n A 1 17 PRO 17 111 111 PRO PRO A . n A 1 18 VAL 18 112 112 VAL VAL A . n A 1 19 LEU 19 113 113 LEU LEU A . n A 1 20 LYS 20 114 114 LYS LYS A . n A 1 21 PHE 21 115 115 PHE PHE A . n A 1 22 VAL 22 116 116 VAL VAL A . n A 1 23 ARG 23 117 117 ARG ARG A . n A 1 24 ASN 24 118 118 ASN ASN A . n A 1 25 VAL 25 119 119 VAL VAL A . n A 1 26 PRO 26 120 120 PRO PRO A . n A 1 27 TRP 27 121 121 TRP TRP A . n A 1 28 GLU 28 122 122 GLU GLU A . n A 1 29 PHE 29 123 123 PHE PHE A . n A 1 30 GLY 30 124 124 GLY GLY A . n A 1 31 ASP 31 125 125 ASP ASP A . n A 1 32 VAL 32 126 126 VAL VAL A . n A 1 33 ILE 33 127 127 ILE ILE A . n A 1 34 PRO 34 128 128 PRO PRO A . n A 1 35 ASP 35 129 129 ASP ASP A . n A 1 36 TYR 36 130 130 TYR TYR A . n A 1 37 VAL 37 131 131 VAL VAL A . n A 1 38 LEU 38 132 132 LEU LEU A . n A 1 39 GLY 39 133 133 GLY GLY A . n A 1 40 GLN 40 134 134 GLN GLN A . n A 1 41 SER 41 135 135 SER SER A . n A 1 42 THR 42 136 136 THR THR A . n A 1 43 CYS 43 137 137 CYS CYS A . n A 1 44 ALA 44 138 138 ALA ALA A . n A 1 45 LEU 45 139 139 LEU LEU A . n A 1 46 PHE 46 140 140 PHE PHE A . n A 1 47 LEU 47 141 141 LEU LEU A . n A 1 48 SER 48 142 142 SER SER A . n A 1 49 LEU 49 143 143 LEU LEU A . n A 1 50 ARG 50 144 144 ARG ARG A . n A 1 51 TYR 51 145 145 TYR TYR A . n A 1 52 HIS 52 146 146 HIS HIS A . n A 1 53 ASN 53 147 147 ASN ASN A . n A 1 54 LEU 54 148 148 LEU LEU A . n A 1 55 HIS 55 149 149 HIS HIS A . n A 1 56 PRO 56 150 150 PRO PRO A . n A 1 57 ASP 57 151 151 ASP ASP A . n A 1 58 TYR 58 152 152 TYR TYR A . n A 1 59 ILE 59 153 153 ILE ILE A . n A 1 60 HIS 60 154 154 HIS HIS A . n A 1 61 GLY 61 155 155 GLY GLY A . n A 1 62 ARG 62 156 156 ARG ARG A . n A 1 63 LEU 63 157 157 LEU LEU A . n A 1 64 GLN 64 158 158 GLN GLN A . n A 1 65 SER 65 159 159 SER SER A . n A 1 66 LEU 66 160 160 LEU LEU A . n A 1 67 GLY 67 161 161 GLY GLY A . n A 1 68 LYS 68 162 162 LYS LYS A . n A 1 69 ASN 69 163 163 ASN ASN A . n A 1 70 PHE 70 164 164 PHE PHE A . n A 1 71 ALA 71 165 165 ALA ALA A . n A 1 72 LEU 72 166 166 LEU LEU A . n A 1 73 ARG 73 167 167 ARG ARG A . n A 1 74 VAL 74 168 168 VAL VAL A . n A 1 75 LEU 75 169 169 LEU LEU A . n A 1 76 LEU 76 170 170 LEU LEU A . n A 1 77 VAL 77 171 171 VAL VAL A . n A 1 78 GLN 78 172 172 GLN GLN A . n A 1 79 VAL 79 173 173 VAL VAL A . n A 1 80 ASP 80 174 174 ASP ASP A . n A 1 81 VAL 81 175 175 VAL VAL A . n A 1 82 LYS 82 176 176 LYS LYS A . n A 1 83 ASP 83 177 177 ASP ASP A . n A 1 84 PRO 84 178 178 PRO PRO A . n A 1 85 GLN 85 179 179 GLN GLN A . n A 1 86 GLN 86 180 180 GLN GLN A . n A 1 87 ALA 87 181 181 ALA ALA A . n A 1 88 LEU 88 182 182 LEU LEU A . n A 1 89 LYS 89 183 183 LYS LYS A . n A 1 90 GLU 90 184 184 GLU GLU A . n A 1 91 LEU 91 185 185 LEU LEU A . n A 1 92 ALA 92 186 186 ALA ALA A . n A 1 93 LYS 93 187 187 LYS LYS A . n A 1 94 MET 94 188 188 MET MET A . n A 1 95 CYS 95 189 189 CYS CYS A . n A 1 96 ILE 96 190 190 ILE ILE A . n A 1 97 LEU 97 191 191 LEU LEU A . n A 1 98 ALA 98 192 192 ALA ALA A . n A 1 99 ASP 99 193 193 ASP ASP A . n A 1 100 CYS 100 194 194 CYS CYS A . n A 1 101 THR 101 195 195 THR THR A . n A 1 102 LEU 102 196 196 LEU LEU A . n A 1 103 ILE 103 197 197 ILE ILE A . n A 1 104 LEU 104 198 198 LEU LEU A . n A 1 105 ALA 105 199 199 ALA ALA A . n A 1 106 TRP 106 200 200 TRP TRP A . n A 1 107 SER 107 201 201 SER SER A . n A 1 108 PRO 108 202 202 PRO PRO A . n A 1 109 GLU 109 203 203 GLU GLU A . n A 1 110 GLU 110 204 204 GLU GLU A . n A 1 111 ALA 111 205 205 ALA ALA A . n A 1 112 GLY 112 206 206 GLY GLY A . n A 1 113 ARG 113 207 207 ARG ARG A . n A 1 114 TYR 114 208 208 TYR TYR A . n A 1 115 LEU 115 209 209 LEU LEU A . n A 1 116 GLU 116 210 210 GLU GLU A . n A 1 117 THR 117 211 211 THR THR A . n A 1 118 TYR 118 212 212 TYR TYR A . n A 1 119 LYS 119 213 213 LYS LYS A . n A 1 120 ALA 120 214 214 ALA ALA A . n A 1 121 TYR 121 215 215 TYR TYR A . n A 1 122 GLU 122 216 216 GLU GLU A . n A 1 123 GLN 123 217 217 GLN GLN A . n A 1 124 LYS 124 218 218 LYS LYS A . n A 1 125 PRO 125 219 219 PRO PRO A . n A 1 126 GLY 126 220 ? ? ? A . n A 1 127 GLY 127 221 ? ? ? A . n A 1 128 LEU 128 222 ? ? ? A . n A 1 129 GLU 129 223 ? ? ? A . n A 1 130 HIS 130 224 ? ? ? A . n A 1 131 HIS 131 225 ? ? ? A . n A 1 132 HIS 132 226 ? ? ? A . n A 1 133 HIS 133 227 ? ? ? A . n A 1 134 HIS 134 228 ? ? ? A . n A 1 135 HIS 135 229 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JPD _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JPD _struct.title 'Solution structure of the ERCC1 central domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JPD _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'PROTEIN, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ERCC1_HUMAN _struct_ref.pdbx_db_accession P07992 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDV KDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKP ; _struct_ref.pdbx_align_begin 96 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JPD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07992 _struct_ref_seq.db_align_beg 96 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 219 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 96 _struct_ref_seq.pdbx_auth_seq_align_end 219 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JPD MET A 1 ? UNP P07992 ? ? 'expression tag' 95 1 1 2JPD GLY A 126 ? UNP P07992 ? ? 'expression tag' 220 2 1 2JPD GLY A 127 ? UNP P07992 ? ? 'expression tag' 221 3 1 2JPD LEU A 128 ? UNP P07992 ? ? 'expression tag' 222 4 1 2JPD GLU A 129 ? UNP P07992 ? ? 'expression tag' 223 5 1 2JPD HIS A 130 ? UNP P07992 ? ? 'expression tag' 224 6 1 2JPD HIS A 131 ? UNP P07992 ? ? 'expression tag' 225 7 1 2JPD HIS A 132 ? UNP P07992 ? ? 'expression tag' 226 8 1 2JPD HIS A 133 ? UNP P07992 ? ? 'expression tag' 227 9 1 2JPD HIS A 134 ? UNP P07992 ? ? 'expression tag' 228 10 1 2JPD HIS A 135 ? UNP P07992 ? ? 'expression tag' 229 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 11 ? ARG A 14 ? PRO A 105 ARG A 108 5 ? 4 HELX_P HELX_P2 2 ASN A 16 ? VAL A 22 ? ASN A 110 VAL A 116 1 ? 7 HELX_P HELX_P3 3 LEU A 49 ? HIS A 55 ? LEU A 143 HIS A 149 1 ? 7 HELX_P HELX_P4 4 PRO A 56 ? PHE A 70 ? PRO A 150 PHE A 164 1 ? 15 HELX_P HELX_P5 5 PRO A 84 ? ASP A 99 ? PRO A 178 ASP A 193 1 ? 16 HELX_P HELX_P6 6 SER A 107 ? GLU A 122 ? SER A 201 GLU A 216 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel A 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 27 ? PHE A 29 ? TRP A 121 PHE A 123 A 2 ILE A 7 ? VAL A 9 ? ILE A 101 VAL A 103 A 3 TYR A 36 ? GLY A 39 ? TYR A 130 GLY A 133 A 4 THR A 42 ? SER A 48 ? THR A 136 SER A 142 A 5 LEU A 72 ? GLN A 78 ? LEU A 166 GLN A 172 A 6 THR A 101 ? ALA A 105 ? THR A 195 ALA A 199 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 28 ? O GLU A 122 N VAL A 9 ? N VAL A 103 A 2 3 N ILE A 8 ? N ILE A 102 O VAL A 37 ? O VAL A 131 A 3 4 N TYR A 36 ? N TYR A 130 O ALA A 44 ? O ALA A 138 A 4 5 N CYS A 43 ? N CYS A 137 O VAL A 74 ? O VAL A 168 A 5 6 N LEU A 75 ? N LEU A 169 O THR A 101 ? O THR A 195 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A ALA 186 ? ? HG A CYS 189 ? ? 1.57 2 4 O A ALA 186 ? ? HG A CYS 189 ? ? 1.60 3 6 O A ALA 186 ? ? HG A CYS 189 ? ? 1.59 4 8 O A ALA 186 ? ? HG A CYS 189 ? ? 1.60 5 12 O A ALA 186 ? ? HG A CYS 189 ? ? 1.58 6 17 HG A CYS 189 ? ? O A CYS 194 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 117 ? ? -153.76 -13.42 2 1 ASP A 125 ? ? 55.59 104.34 3 1 ALA A 165 ? ? -91.85 -64.06 4 2 ARG A 117 ? ? -151.18 -12.41 5 2 ASP A 125 ? ? 59.47 87.00 6 3 SER A 100 ? ? 64.49 170.83 7 3 ARG A 117 ? ? -144.83 -17.89 8 3 ASP A 125 ? ? 60.49 86.71 9 3 LYS A 162 ? ? 176.87 -30.85 10 4 ARG A 117 ? ? -154.23 2.13 11 4 ASP A 125 ? ? 49.02 102.84 12 4 PRO A 128 ? ? -73.96 -162.02 13 4 LYS A 162 ? ? 176.04 -32.64 14 4 GLU A 216 ? ? -113.54 76.59 15 5 ASN A 99 ? ? 57.84 71.92 16 5 ARG A 117 ? ? -147.20 -13.08 17 5 ASP A 125 ? ? 60.02 97.68 18 5 GLU A 216 ? ? 70.61 -87.13 19 5 GLN A 217 ? ? 63.64 -42.43 20 6 ARG A 117 ? ? -163.20 -0.44 21 6 ASP A 125 ? ? 54.29 84.73 22 6 ALA A 165 ? ? -95.35 -66.20 23 6 GLU A 216 ? ? -118.04 78.70 24 7 ARG A 117 ? ? -156.14 6.36 25 7 ASP A 125 ? ? 54.27 87.25 26 8 SER A 98 ? ? -160.86 107.30 27 8 ASN A 99 ? ? 48.48 70.44 28 8 ARG A 117 ? ? -149.33 -3.87 29 8 ASP A 125 ? ? 50.13 89.71 30 8 ALA A 165 ? ? -130.13 -56.59 31 8 ASP A 193 ? ? 61.78 72.25 32 8 GLU A 216 ? ? 72.82 -68.69 33 8 GLN A 217 ? ? 51.67 -152.36 34 9 ASN A 99 ? ? -106.12 -81.06 35 9 ARG A 117 ? ? -154.59 -0.93 36 9 ASP A 125 ? ? 53.67 92.51 37 9 PRO A 128 ? ? -74.31 -169.31 38 10 SER A 98 ? ? 53.22 90.57 39 10 ASP A 125 ? ? 32.78 92.65 40 11 SER A 98 ? ? -109.24 65.53 41 11 ASP A 125 ? ? 55.07 92.31 42 11 ASP A 174 ? ? -154.05 30.74 43 11 GLU A 216 ? ? -113.97 65.03 44 12 ASN A 99 ? ? 52.23 77.84 45 12 ARG A 117 ? ? -155.25 -0.06 46 12 ASP A 125 ? ? 45.82 95.25 47 12 ASP A 193 ? ? 55.00 71.24 48 13 SER A 98 ? ? -46.19 -80.99 49 13 ASN A 99 ? ? 68.76 -51.05 50 13 SER A 100 ? ? 59.04 -172.60 51 13 ARG A 117 ? ? -153.49 5.43 52 13 ASP A 125 ? ? 53.06 85.69 53 13 ASP A 174 ? ? -140.53 29.05 54 13 ASP A 193 ? ? 62.68 70.67 55 13 GLU A 216 ? ? -111.69 75.66 56 14 ARG A 117 ? ? -167.03 7.58 57 14 ASP A 125 ? ? 47.36 91.16 58 14 ASP A 193 ? ? 55.31 71.12 59 15 ASN A 99 ? ? 74.53 -49.34 60 15 ARG A 117 ? ? -152.04 1.51 61 15 ASP A 125 ? ? 55.79 98.07 62 15 ASP A 174 ? ? -140.99 12.02 63 15 ASP A 193 ? ? 56.65 72.84 64 15 GLU A 216 ? ? 97.14 -66.38 65 15 GLN A 217 ? ? -167.71 27.98 66 16 ARG A 117 ? ? -150.33 -16.85 67 16 ASP A 125 ? ? 65.15 97.46 68 16 PRO A 128 ? ? -75.92 -157.25 69 17 ASN A 99 ? ? 72.03 -33.61 70 17 SER A 100 ? ? 67.49 161.03 71 17 ARG A 117 ? ? -144.43 -15.64 72 17 ASP A 125 ? ? 54.28 104.08 73 18 SER A 98 ? ? -152.68 8.63 74 18 ARG A 117 ? ? -152.68 -2.64 75 18 ASP A 125 ? ? 47.80 90.53 76 18 GLN A 217 ? ? -66.48 7.92 77 19 ASP A 125 ? ? 62.38 96.82 78 19 ASP A 174 ? ? -144.86 14.78 79 20 ARG A 117 ? ? -151.17 13.08 80 20 ASP A 125 ? ? 158.90 117.28 81 20 PRO A 128 ? ? -71.65 -168.77 82 20 ASP A 193 ? ? 68.30 72.83 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 144 ? ? 0.076 'SIDE CHAIN' 2 1 ARG A 207 ? ? 0.089 'SIDE CHAIN' 3 2 ARG A 156 ? ? 0.116 'SIDE CHAIN' 4 11 ARG A 106 ? ? 0.082 'SIDE CHAIN' 5 18 ARG A 106 ? ? 0.106 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JPD _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JPD _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '50 mM sodium phosphate, 100 mM sodium chloride, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 50 mM ? 1 'sodium chloride' 100 mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 290 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-13C NOESY' 1 4 1 '3D (H)CCH 1H-13C NOESY' 1 5 1 '2D NOESY 15N filtered' # _pdbx_nmr_refine.entry_id 2JPD _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 Goddard 'data analysis' Sparky ? 3 Goddard 'peak picking' Sparky ? 4 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 95 ? A MET 1 2 1 Y 1 A GLY 220 ? A GLY 126 3 1 Y 1 A GLY 221 ? A GLY 127 4 1 Y 1 A LEU 222 ? A LEU 128 5 1 Y 1 A GLU 223 ? A GLU 129 6 1 Y 1 A HIS 224 ? A HIS 130 7 1 Y 1 A HIS 225 ? A HIS 131 8 1 Y 1 A HIS 226 ? A HIS 132 9 1 Y 1 A HIS 227 ? A HIS 133 10 1 Y 1 A HIS 228 ? A HIS 134 11 1 Y 1 A HIS 229 ? A HIS 135 12 2 Y 1 A MET 95 ? A MET 1 13 2 Y 1 A GLY 220 ? A GLY 126 14 2 Y 1 A GLY 221 ? A GLY 127 15 2 Y 1 A LEU 222 ? A LEU 128 16 2 Y 1 A GLU 223 ? A GLU 129 17 2 Y 1 A HIS 224 ? A HIS 130 18 2 Y 1 A HIS 225 ? A HIS 131 19 2 Y 1 A HIS 226 ? A HIS 132 20 2 Y 1 A HIS 227 ? A HIS 133 21 2 Y 1 A HIS 228 ? A HIS 134 22 2 Y 1 A HIS 229 ? A HIS 135 23 3 Y 1 A MET 95 ? A MET 1 24 3 Y 1 A GLY 220 ? A GLY 126 25 3 Y 1 A GLY 221 ? A GLY 127 26 3 Y 1 A LEU 222 ? A LEU 128 27 3 Y 1 A GLU 223 ? A GLU 129 28 3 Y 1 A HIS 224 ? A HIS 130 29 3 Y 1 A HIS 225 ? A HIS 131 30 3 Y 1 A HIS 226 ? A HIS 132 31 3 Y 1 A HIS 227 ? A HIS 133 32 3 Y 1 A HIS 228 ? A HIS 134 33 3 Y 1 A HIS 229 ? A HIS 135 34 4 Y 1 A MET 95 ? A MET 1 35 4 Y 1 A GLY 220 ? A GLY 126 36 4 Y 1 A GLY 221 ? A GLY 127 37 4 Y 1 A LEU 222 ? A LEU 128 38 4 Y 1 A GLU 223 ? A GLU 129 39 4 Y 1 A HIS 224 ? A HIS 130 40 4 Y 1 A HIS 225 ? A HIS 131 41 4 Y 1 A HIS 226 ? A HIS 132 42 4 Y 1 A HIS 227 ? A HIS 133 43 4 Y 1 A HIS 228 ? A HIS 134 44 4 Y 1 A HIS 229 ? A HIS 135 45 5 Y 1 A MET 95 ? A MET 1 46 5 Y 1 A GLY 220 ? A GLY 126 47 5 Y 1 A GLY 221 ? A GLY 127 48 5 Y 1 A LEU 222 ? A LEU 128 49 5 Y 1 A GLU 223 ? A GLU 129 50 5 Y 1 A HIS 224 ? A HIS 130 51 5 Y 1 A HIS 225 ? A HIS 131 52 5 Y 1 A HIS 226 ? A HIS 132 53 5 Y 1 A HIS 227 ? A HIS 133 54 5 Y 1 A HIS 228 ? A HIS 134 55 5 Y 1 A HIS 229 ? A HIS 135 56 6 Y 1 A MET 95 ? A MET 1 57 6 Y 1 A GLY 220 ? A GLY 126 58 6 Y 1 A GLY 221 ? A GLY 127 59 6 Y 1 A LEU 222 ? A LEU 128 60 6 Y 1 A GLU 223 ? A GLU 129 61 6 Y 1 A HIS 224 ? A HIS 130 62 6 Y 1 A HIS 225 ? A HIS 131 63 6 Y 1 A HIS 226 ? A HIS 132 64 6 Y 1 A HIS 227 ? A HIS 133 65 6 Y 1 A HIS 228 ? A HIS 134 66 6 Y 1 A HIS 229 ? A HIS 135 67 7 Y 1 A MET 95 ? A MET 1 68 7 Y 1 A GLY 220 ? A GLY 126 69 7 Y 1 A GLY 221 ? A GLY 127 70 7 Y 1 A LEU 222 ? A LEU 128 71 7 Y 1 A GLU 223 ? A GLU 129 72 7 Y 1 A HIS 224 ? A HIS 130 73 7 Y 1 A HIS 225 ? A HIS 131 74 7 Y 1 A HIS 226 ? A HIS 132 75 7 Y 1 A HIS 227 ? A HIS 133 76 7 Y 1 A HIS 228 ? A HIS 134 77 7 Y 1 A HIS 229 ? A HIS 135 78 8 Y 1 A MET 95 ? A MET 1 79 8 Y 1 A GLY 220 ? A GLY 126 80 8 Y 1 A GLY 221 ? A GLY 127 81 8 Y 1 A LEU 222 ? A LEU 128 82 8 Y 1 A GLU 223 ? A GLU 129 83 8 Y 1 A HIS 224 ? A HIS 130 84 8 Y 1 A HIS 225 ? A HIS 131 85 8 Y 1 A HIS 226 ? A HIS 132 86 8 Y 1 A HIS 227 ? A HIS 133 87 8 Y 1 A HIS 228 ? A HIS 134 88 8 Y 1 A HIS 229 ? A HIS 135 89 9 Y 1 A MET 95 ? A MET 1 90 9 Y 1 A GLY 220 ? A GLY 126 91 9 Y 1 A GLY 221 ? A GLY 127 92 9 Y 1 A LEU 222 ? A LEU 128 93 9 Y 1 A GLU 223 ? A GLU 129 94 9 Y 1 A HIS 224 ? A HIS 130 95 9 Y 1 A HIS 225 ? A HIS 131 96 9 Y 1 A HIS 226 ? A HIS 132 97 9 Y 1 A HIS 227 ? A HIS 133 98 9 Y 1 A HIS 228 ? A HIS 134 99 9 Y 1 A HIS 229 ? A HIS 135 100 10 Y 1 A MET 95 ? A MET 1 101 10 Y 1 A GLY 220 ? A GLY 126 102 10 Y 1 A GLY 221 ? A GLY 127 103 10 Y 1 A LEU 222 ? A LEU 128 104 10 Y 1 A GLU 223 ? A GLU 129 105 10 Y 1 A HIS 224 ? A HIS 130 106 10 Y 1 A HIS 225 ? A HIS 131 107 10 Y 1 A HIS 226 ? A HIS 132 108 10 Y 1 A HIS 227 ? A HIS 133 109 10 Y 1 A HIS 228 ? A HIS 134 110 10 Y 1 A HIS 229 ? A HIS 135 111 11 Y 1 A MET 95 ? A MET 1 112 11 Y 1 A GLY 220 ? A GLY 126 113 11 Y 1 A GLY 221 ? A GLY 127 114 11 Y 1 A LEU 222 ? A LEU 128 115 11 Y 1 A GLU 223 ? A GLU 129 116 11 Y 1 A HIS 224 ? A HIS 130 117 11 Y 1 A HIS 225 ? A HIS 131 118 11 Y 1 A HIS 226 ? A HIS 132 119 11 Y 1 A HIS 227 ? A HIS 133 120 11 Y 1 A HIS 228 ? A HIS 134 121 11 Y 1 A HIS 229 ? A HIS 135 122 12 Y 1 A MET 95 ? A MET 1 123 12 Y 1 A GLY 220 ? A GLY 126 124 12 Y 1 A GLY 221 ? A GLY 127 125 12 Y 1 A LEU 222 ? A LEU 128 126 12 Y 1 A GLU 223 ? A GLU 129 127 12 Y 1 A HIS 224 ? A HIS 130 128 12 Y 1 A HIS 225 ? A HIS 131 129 12 Y 1 A HIS 226 ? A HIS 132 130 12 Y 1 A HIS 227 ? A HIS 133 131 12 Y 1 A HIS 228 ? A HIS 134 132 12 Y 1 A HIS 229 ? A HIS 135 133 13 Y 1 A MET 95 ? A MET 1 134 13 Y 1 A GLY 220 ? A GLY 126 135 13 Y 1 A GLY 221 ? A GLY 127 136 13 Y 1 A LEU 222 ? A LEU 128 137 13 Y 1 A GLU 223 ? A GLU 129 138 13 Y 1 A HIS 224 ? A HIS 130 139 13 Y 1 A HIS 225 ? A HIS 131 140 13 Y 1 A HIS 226 ? A HIS 132 141 13 Y 1 A HIS 227 ? A HIS 133 142 13 Y 1 A HIS 228 ? A HIS 134 143 13 Y 1 A HIS 229 ? A HIS 135 144 14 Y 1 A MET 95 ? A MET 1 145 14 Y 1 A GLY 220 ? A GLY 126 146 14 Y 1 A GLY 221 ? A GLY 127 147 14 Y 1 A LEU 222 ? A LEU 128 148 14 Y 1 A GLU 223 ? A GLU 129 149 14 Y 1 A HIS 224 ? A HIS 130 150 14 Y 1 A HIS 225 ? A HIS 131 151 14 Y 1 A HIS 226 ? A HIS 132 152 14 Y 1 A HIS 227 ? A HIS 133 153 14 Y 1 A HIS 228 ? A HIS 134 154 14 Y 1 A HIS 229 ? A HIS 135 155 15 Y 1 A MET 95 ? A MET 1 156 15 Y 1 A GLY 220 ? A GLY 126 157 15 Y 1 A GLY 221 ? A GLY 127 158 15 Y 1 A LEU 222 ? A LEU 128 159 15 Y 1 A GLU 223 ? A GLU 129 160 15 Y 1 A HIS 224 ? A HIS 130 161 15 Y 1 A HIS 225 ? A HIS 131 162 15 Y 1 A HIS 226 ? A HIS 132 163 15 Y 1 A HIS 227 ? A HIS 133 164 15 Y 1 A HIS 228 ? A HIS 134 165 15 Y 1 A HIS 229 ? A HIS 135 166 16 Y 1 A MET 95 ? A MET 1 167 16 Y 1 A GLY 220 ? A GLY 126 168 16 Y 1 A GLY 221 ? A GLY 127 169 16 Y 1 A LEU 222 ? A LEU 128 170 16 Y 1 A GLU 223 ? A GLU 129 171 16 Y 1 A HIS 224 ? A HIS 130 172 16 Y 1 A HIS 225 ? A HIS 131 173 16 Y 1 A HIS 226 ? A HIS 132 174 16 Y 1 A HIS 227 ? A HIS 133 175 16 Y 1 A HIS 228 ? A HIS 134 176 16 Y 1 A HIS 229 ? A HIS 135 177 17 Y 1 A MET 95 ? A MET 1 178 17 Y 1 A GLY 220 ? A GLY 126 179 17 Y 1 A GLY 221 ? A GLY 127 180 17 Y 1 A LEU 222 ? A LEU 128 181 17 Y 1 A GLU 223 ? A GLU 129 182 17 Y 1 A HIS 224 ? A HIS 130 183 17 Y 1 A HIS 225 ? A HIS 131 184 17 Y 1 A HIS 226 ? A HIS 132 185 17 Y 1 A HIS 227 ? A HIS 133 186 17 Y 1 A HIS 228 ? A HIS 134 187 17 Y 1 A HIS 229 ? A HIS 135 188 18 Y 1 A MET 95 ? A MET 1 189 18 Y 1 A GLY 220 ? A GLY 126 190 18 Y 1 A GLY 221 ? A GLY 127 191 18 Y 1 A LEU 222 ? A LEU 128 192 18 Y 1 A GLU 223 ? A GLU 129 193 18 Y 1 A HIS 224 ? A HIS 130 194 18 Y 1 A HIS 225 ? A HIS 131 195 18 Y 1 A HIS 226 ? A HIS 132 196 18 Y 1 A HIS 227 ? A HIS 133 197 18 Y 1 A HIS 228 ? A HIS 134 198 18 Y 1 A HIS 229 ? A HIS 135 199 19 Y 1 A MET 95 ? A MET 1 200 19 Y 1 A GLY 220 ? A GLY 126 201 19 Y 1 A GLY 221 ? A GLY 127 202 19 Y 1 A LEU 222 ? A LEU 128 203 19 Y 1 A GLU 223 ? A GLU 129 204 19 Y 1 A HIS 224 ? A HIS 130 205 19 Y 1 A HIS 225 ? A HIS 131 206 19 Y 1 A HIS 226 ? A HIS 132 207 19 Y 1 A HIS 227 ? A HIS 133 208 19 Y 1 A HIS 228 ? A HIS 134 209 19 Y 1 A HIS 229 ? A HIS 135 210 20 Y 1 A MET 95 ? A MET 1 211 20 Y 1 A GLY 220 ? A GLY 126 212 20 Y 1 A GLY 221 ? A GLY 127 213 20 Y 1 A LEU 222 ? A LEU 128 214 20 Y 1 A GLU 223 ? A GLU 129 215 20 Y 1 A HIS 224 ? A HIS 130 216 20 Y 1 A HIS 225 ? A HIS 131 217 20 Y 1 A HIS 226 ? A HIS 132 218 20 Y 1 A HIS 227 ? A HIS 133 219 20 Y 1 A HIS 228 ? A HIS 134 220 20 Y 1 A HIS 229 ? A HIS 135 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 900 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2JPD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_