data_2JPK # _entry.id 2JPK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JPK pdb_00002jpk 10.2210/pdb2jpk/pdb RCSB RCSB100128 ? ? WWPDB D_1000100128 ? ? BMRB 15261 ? 10.13018/BMR15261 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2023-12-20 6 'Structure model' 1 5 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' 9 5 'Structure model' Other 10 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond 11 5 'Structure model' pdbx_database_status 12 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 5 'Structure model' '_pdbx_database_status.deposit_site' 8 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JPK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-05-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15261 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rogne, P.' 1 'Fimland, G.' 2 'Nissen-Meyer, J.' 3 'Kristiansen, P.E.' 4 # _citation.id primary _citation.title 'Three-dimensional structure of the two peptides that constitute the two-peptide bacteriocin lactococcin G' _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1784 _citation.page_first 543 _citation.page_last 554 _citation.year 2008 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18187052 _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2007.12.002 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rogne, P.' 1 ? primary 'Fimland, G.' 2 ? primary 'Nissen-Meyer, J.' 3 ? primary 'Kristiansen, P.E.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Bacteriocin lactococcin-G subunit beta' _entity.formula_weight 4117.792 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KKWGWLAWVDPAYEFIKGFGKGAIKEGNKDKWKNI _entity_poly.pdbx_seq_one_letter_code_can KKWGWLAWVDPAYEFIKGFGKGAIKEGNKDKWKNI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LYS n 1 3 TRP n 1 4 GLY n 1 5 TRP n 1 6 LEU n 1 7 ALA n 1 8 TRP n 1 9 VAL n 1 10 ASP n 1 11 PRO n 1 12 ALA n 1 13 TYR n 1 14 GLU n 1 15 PHE n 1 16 ILE n 1 17 LYS n 1 18 GLY n 1 19 PHE n 1 20 GLY n 1 21 LYS n 1 22 GLY n 1 23 ALA n 1 24 ILE n 1 25 LYS n 1 26 GLU n 1 27 GLY n 1 28 ASN n 1 29 LYS n 1 30 ASP n 1 31 LYS n 1 32 TRP n 1 33 LYS n 1 34 ASN n 1 35 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lactococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'LMGT 2081' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus lactis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1358 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant 'RIL (DE3) pLysS' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pGEV2 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ILE 35 35 35 ILE ILE A . n # _cell.entry_id 2JPK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JPK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'LactococcinG beta peptide in DPC micelles' _exptl.entry_id 2JPK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JPK _struct.title 'Lactococcin G-b in DPC' _struct.pdbx_model_details 'LactococcinG beta peptide in DPC micelles' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JPK _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'antimicrobial, membrane bound, ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LCGB_LACLA _struct_ref.pdbx_db_accession P36962 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KKWGWLAWVDPAYEFIKGFGKGAIKEGNKDKWKNI _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JPK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P36962 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 35 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 4 ? GLY A 20 ? GLY A 4 GLY A 20 1 ? 17 HELX_P HELX_P2 2 LYS A 31 ? ILE A 35 ? LYS A 31 ILE A 35 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 23 ? ? -163.70 73.57 2 1 ASP A 30 ? ? -88.47 49.33 3 2 ASP A 30 ? ? -88.90 47.83 4 3 ASN A 28 ? ? -62.08 -170.01 5 3 ASP A 30 ? ? -149.74 29.97 6 4 ASN A 28 ? ? -62.38 96.96 7 4 ASP A 30 ? ? -88.81 48.09 8 5 ASP A 30 ? ? -149.83 43.14 9 6 ALA A 23 ? ? 50.41 83.63 10 6 ASP A 30 ? ? -88.49 49.17 11 7 ALA A 23 ? ? -160.40 92.05 12 7 ASN A 28 ? ? -56.87 100.06 13 7 ASP A 30 ? ? -88.51 49.15 14 8 ASP A 30 ? ? -149.88 47.80 15 9 ASP A 30 ? ? -150.66 29.06 16 10 ALA A 23 ? ? -160.10 27.08 17 10 ASN A 28 ? ? 50.11 86.16 18 10 ASP A 30 ? ? -88.74 48.62 19 11 ASP A 30 ? ? -148.78 47.36 20 12 ASN A 28 ? ? -63.03 94.25 21 12 ASP A 30 ? ? -88.54 48.96 22 13 ALA A 23 ? ? -160.39 95.52 23 13 ASP A 30 ? ? -149.14 47.75 24 14 ASP A 30 ? ? -149.92 37.85 25 15 ASP A 30 ? ? -88.51 49.32 26 16 ASN A 28 ? ? -63.41 94.83 27 16 ASP A 30 ? ? -88.62 48.79 28 17 ASN A 28 ? ? 50.66 88.73 29 18 ASN A 28 ? ? -159.45 84.67 30 19 ASN A 28 ? ? 50.58 88.75 31 19 ASP A 30 ? ? -148.90 53.50 32 20 LYS A 21 ? ? -56.81 -178.18 33 20 LYS A 29 ? ? -76.71 -71.11 34 20 ASP A 30 ? ? -88.34 49.79 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 102 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JPK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JPK _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1 mM [U-15N] lactococcinG beta, 200 mM [U-2H] DPC, 10 % D2O, 0.1 % TFA, 0.2 mM DSS, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'lactococcinG beta' 1 mM '[U-15N]' 1 DPC 200 mM '[U-2H]' 1 D2O 10 % ? 1 TFA 0.1 % ? 1 DSS 0.2 mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 2.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D 1H-15N TOCSY' 1 5 1 '3D 1H-15N NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JPK _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 36 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 544 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 249 _pdbx_nmr_constraints.NOE_long_range_total_count 0 _pdbx_nmr_constraints.NOE_medium_range_total_count 101 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 194 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 18 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 18 # _pdbx_nmr_refine.entry_id 2JPK _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 1.3 1 'Bruker Biospin' processing TopSpin 1.3 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.4.1 4 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 6 'Koradi, Billeter and Wuthrich' visualization MOLMOL 2k.2 7 'Koradi, Billeter and Wuthrich' 'rmsd value calculation' MOLMOL 2k.2 8 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 9 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLU N N N N 47 GLU CA C N S 48 GLU C C N N 49 GLU O O N N 50 GLU CB C N N 51 GLU CG C N N 52 GLU CD C N N 53 GLU OE1 O N N 54 GLU OE2 O N N 55 GLU OXT O N N 56 GLU H H N N 57 GLU H2 H N N 58 GLU HA H N N 59 GLU HB2 H N N 60 GLU HB3 H N N 61 GLU HG2 H N N 62 GLU HG3 H N N 63 GLU HE2 H N N 64 GLU HXT H N N 65 GLY N N N N 66 GLY CA C N N 67 GLY C C N N 68 GLY O O N N 69 GLY OXT O N N 70 GLY H H N N 71 GLY H2 H N N 72 GLY HA2 H N N 73 GLY HA3 H N N 74 GLY HXT H N N 75 ILE N N N N 76 ILE CA C N S 77 ILE C C N N 78 ILE O O N N 79 ILE CB C N S 80 ILE CG1 C N N 81 ILE CG2 C N N 82 ILE CD1 C N N 83 ILE OXT O N N 84 ILE H H N N 85 ILE H2 H N N 86 ILE HA H N N 87 ILE HB H N N 88 ILE HG12 H N N 89 ILE HG13 H N N 90 ILE HG21 H N N 91 ILE HG22 H N N 92 ILE HG23 H N N 93 ILE HD11 H N N 94 ILE HD12 H N N 95 ILE HD13 H N N 96 ILE HXT H N N 97 LEU N N N N 98 LEU CA C N S 99 LEU C C N N 100 LEU O O N N 101 LEU CB C N N 102 LEU CG C N N 103 LEU CD1 C N N 104 LEU CD2 C N N 105 LEU OXT O N N 106 LEU H H N N 107 LEU H2 H N N 108 LEU HA H N N 109 LEU HB2 H N N 110 LEU HB3 H N N 111 LEU HG H N N 112 LEU HD11 H N N 113 LEU HD12 H N N 114 LEU HD13 H N N 115 LEU HD21 H N N 116 LEU HD22 H N N 117 LEU HD23 H N N 118 LEU HXT H N N 119 LYS N N N N 120 LYS CA C N S 121 LYS C C N N 122 LYS O O N N 123 LYS CB C N N 124 LYS CG C N N 125 LYS CD C N N 126 LYS CE C N N 127 LYS NZ N N N 128 LYS OXT O N N 129 LYS H H N N 130 LYS H2 H N N 131 LYS HA H N N 132 LYS HB2 H N N 133 LYS HB3 H N N 134 LYS HG2 H N N 135 LYS HG3 H N N 136 LYS HD2 H N N 137 LYS HD3 H N N 138 LYS HE2 H N N 139 LYS HE3 H N N 140 LYS HZ1 H N N 141 LYS HZ2 H N N 142 LYS HZ3 H N N 143 LYS HXT H N N 144 PHE N N N N 145 PHE CA C N S 146 PHE C C N N 147 PHE O O N N 148 PHE CB C N N 149 PHE CG C Y N 150 PHE CD1 C Y N 151 PHE CD2 C Y N 152 PHE CE1 C Y N 153 PHE CE2 C Y N 154 PHE CZ C Y N 155 PHE OXT O N N 156 PHE H H N N 157 PHE H2 H N N 158 PHE HA H N N 159 PHE HB2 H N N 160 PHE HB3 H N N 161 PHE HD1 H N N 162 PHE HD2 H N N 163 PHE HE1 H N N 164 PHE HE2 H N N 165 PHE HZ H N N 166 PHE HXT H N N 167 PRO N N N N 168 PRO CA C N S 169 PRO C C N N 170 PRO O O N N 171 PRO CB C N N 172 PRO CG C N N 173 PRO CD C N N 174 PRO OXT O N N 175 PRO H H N N 176 PRO HA H N N 177 PRO HB2 H N N 178 PRO HB3 H N N 179 PRO HG2 H N N 180 PRO HG3 H N N 181 PRO HD2 H N N 182 PRO HD3 H N N 183 PRO HXT H N N 184 TRP N N N N 185 TRP CA C N S 186 TRP C C N N 187 TRP O O N N 188 TRP CB C N N 189 TRP CG C Y N 190 TRP CD1 C Y N 191 TRP CD2 C Y N 192 TRP NE1 N Y N 193 TRP CE2 C Y N 194 TRP CE3 C Y N 195 TRP CZ2 C Y N 196 TRP CZ3 C Y N 197 TRP CH2 C Y N 198 TRP OXT O N N 199 TRP H H N N 200 TRP H2 H N N 201 TRP HA H N N 202 TRP HB2 H N N 203 TRP HB3 H N N 204 TRP HD1 H N N 205 TRP HE1 H N N 206 TRP HE3 H N N 207 TRP HZ2 H N N 208 TRP HZ3 H N N 209 TRP HH2 H N N 210 TRP HXT H N N 211 TYR N N N N 212 TYR CA C N S 213 TYR C C N N 214 TYR O O N N 215 TYR CB C N N 216 TYR CG C Y N 217 TYR CD1 C Y N 218 TYR CD2 C Y N 219 TYR CE1 C Y N 220 TYR CE2 C Y N 221 TYR CZ C Y N 222 TYR OH O N N 223 TYR OXT O N N 224 TYR H H N N 225 TYR H2 H N N 226 TYR HA H N N 227 TYR HB2 H N N 228 TYR HB3 H N N 229 TYR HD1 H N N 230 TYR HD2 H N N 231 TYR HE1 H N N 232 TYR HE2 H N N 233 TYR HH H N N 234 TYR HXT H N N 235 VAL N N N N 236 VAL CA C N S 237 VAL C C N N 238 VAL O O N N 239 VAL CB C N N 240 VAL CG1 C N N 241 VAL CG2 C N N 242 VAL OXT O N N 243 VAL H H N N 244 VAL H2 H N N 245 VAL HA H N N 246 VAL HB H N N 247 VAL HG11 H N N 248 VAL HG12 H N N 249 VAL HG13 H N N 250 VAL HG21 H N N 251 VAL HG22 H N N 252 VAL HG23 H N N 253 VAL HXT H N N 254 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLU N CA sing N N 44 GLU N H sing N N 45 GLU N H2 sing N N 46 GLU CA C sing N N 47 GLU CA CB sing N N 48 GLU CA HA sing N N 49 GLU C O doub N N 50 GLU C OXT sing N N 51 GLU CB CG sing N N 52 GLU CB HB2 sing N N 53 GLU CB HB3 sing N N 54 GLU CG CD sing N N 55 GLU CG HG2 sing N N 56 GLU CG HG3 sing N N 57 GLU CD OE1 doub N N 58 GLU CD OE2 sing N N 59 GLU OE2 HE2 sing N N 60 GLU OXT HXT sing N N 61 GLY N CA sing N N 62 GLY N H sing N N 63 GLY N H2 sing N N 64 GLY CA C sing N N 65 GLY CA HA2 sing N N 66 GLY CA HA3 sing N N 67 GLY C O doub N N 68 GLY C OXT sing N N 69 GLY OXT HXT sing N N 70 ILE N CA sing N N 71 ILE N H sing N N 72 ILE N H2 sing N N 73 ILE CA C sing N N 74 ILE CA CB sing N N 75 ILE CA HA sing N N 76 ILE C O doub N N 77 ILE C OXT sing N N 78 ILE CB CG1 sing N N 79 ILE CB CG2 sing N N 80 ILE CB HB sing N N 81 ILE CG1 CD1 sing N N 82 ILE CG1 HG12 sing N N 83 ILE CG1 HG13 sing N N 84 ILE CG2 HG21 sing N N 85 ILE CG2 HG22 sing N N 86 ILE CG2 HG23 sing N N 87 ILE CD1 HD11 sing N N 88 ILE CD1 HD12 sing N N 89 ILE CD1 HD13 sing N N 90 ILE OXT HXT sing N N 91 LEU N CA sing N N 92 LEU N H sing N N 93 LEU N H2 sing N N 94 LEU CA C sing N N 95 LEU CA CB sing N N 96 LEU CA HA sing N N 97 LEU C O doub N N 98 LEU C OXT sing N N 99 LEU CB CG sing N N 100 LEU CB HB2 sing N N 101 LEU CB HB3 sing N N 102 LEU CG CD1 sing N N 103 LEU CG CD2 sing N N 104 LEU CG HG sing N N 105 LEU CD1 HD11 sing N N 106 LEU CD1 HD12 sing N N 107 LEU CD1 HD13 sing N N 108 LEU CD2 HD21 sing N N 109 LEU CD2 HD22 sing N N 110 LEU CD2 HD23 sing N N 111 LEU OXT HXT sing N N 112 LYS N CA sing N N 113 LYS N H sing N N 114 LYS N H2 sing N N 115 LYS CA C sing N N 116 LYS CA CB sing N N 117 LYS CA HA sing N N 118 LYS C O doub N N 119 LYS C OXT sing N N 120 LYS CB CG sing N N 121 LYS CB HB2 sing N N 122 LYS CB HB3 sing N N 123 LYS CG CD sing N N 124 LYS CG HG2 sing N N 125 LYS CG HG3 sing N N 126 LYS CD CE sing N N 127 LYS CD HD2 sing N N 128 LYS CD HD3 sing N N 129 LYS CE NZ sing N N 130 LYS CE HE2 sing N N 131 LYS CE HE3 sing N N 132 LYS NZ HZ1 sing N N 133 LYS NZ HZ2 sing N N 134 LYS NZ HZ3 sing N N 135 LYS OXT HXT sing N N 136 PHE N CA sing N N 137 PHE N H sing N N 138 PHE N H2 sing N N 139 PHE CA C sing N N 140 PHE CA CB sing N N 141 PHE CA HA sing N N 142 PHE C O doub N N 143 PHE C OXT sing N N 144 PHE CB CG sing N N 145 PHE CB HB2 sing N N 146 PHE CB HB3 sing N N 147 PHE CG CD1 doub Y N 148 PHE CG CD2 sing Y N 149 PHE CD1 CE1 sing Y N 150 PHE CD1 HD1 sing N N 151 PHE CD2 CE2 doub Y N 152 PHE CD2 HD2 sing N N 153 PHE CE1 CZ doub Y N 154 PHE CE1 HE1 sing N N 155 PHE CE2 CZ sing Y N 156 PHE CE2 HE2 sing N N 157 PHE CZ HZ sing N N 158 PHE OXT HXT sing N N 159 PRO N CA sing N N 160 PRO N CD sing N N 161 PRO N H sing N N 162 PRO CA C sing N N 163 PRO CA CB sing N N 164 PRO CA HA sing N N 165 PRO C O doub N N 166 PRO C OXT sing N N 167 PRO CB CG sing N N 168 PRO CB HB2 sing N N 169 PRO CB HB3 sing N N 170 PRO CG CD sing N N 171 PRO CG HG2 sing N N 172 PRO CG HG3 sing N N 173 PRO CD HD2 sing N N 174 PRO CD HD3 sing N N 175 PRO OXT HXT sing N N 176 TRP N CA sing N N 177 TRP N H sing N N 178 TRP N H2 sing N N 179 TRP CA C sing N N 180 TRP CA CB sing N N 181 TRP CA HA sing N N 182 TRP C O doub N N 183 TRP C OXT sing N N 184 TRP CB CG sing N N 185 TRP CB HB2 sing N N 186 TRP CB HB3 sing N N 187 TRP CG CD1 doub Y N 188 TRP CG CD2 sing Y N 189 TRP CD1 NE1 sing Y N 190 TRP CD1 HD1 sing N N 191 TRP CD2 CE2 doub Y N 192 TRP CD2 CE3 sing Y N 193 TRP NE1 CE2 sing Y N 194 TRP NE1 HE1 sing N N 195 TRP CE2 CZ2 sing Y N 196 TRP CE3 CZ3 doub Y N 197 TRP CE3 HE3 sing N N 198 TRP CZ2 CH2 doub Y N 199 TRP CZ2 HZ2 sing N N 200 TRP CZ3 CH2 sing Y N 201 TRP CZ3 HZ3 sing N N 202 TRP CH2 HH2 sing N N 203 TRP OXT HXT sing N N 204 TYR N CA sing N N 205 TYR N H sing N N 206 TYR N H2 sing N N 207 TYR CA C sing N N 208 TYR CA CB sing N N 209 TYR CA HA sing N N 210 TYR C O doub N N 211 TYR C OXT sing N N 212 TYR CB CG sing N N 213 TYR CB HB2 sing N N 214 TYR CB HB3 sing N N 215 TYR CG CD1 doub Y N 216 TYR CG CD2 sing Y N 217 TYR CD1 CE1 sing Y N 218 TYR CD1 HD1 sing N N 219 TYR CD2 CE2 doub Y N 220 TYR CD2 HD2 sing N N 221 TYR CE1 CZ doub Y N 222 TYR CE1 HE1 sing N N 223 TYR CE2 CZ sing Y N 224 TYR CE2 HE2 sing N N 225 TYR CZ OH sing N N 226 TYR OH HH sing N N 227 TYR OXT HXT sing N N 228 VAL N CA sing N N 229 VAL N H sing N N 230 VAL N H2 sing N N 231 VAL CA C sing N N 232 VAL CA CB sing N N 233 VAL CA HA sing N N 234 VAL C O doub N N 235 VAL C OXT sing N N 236 VAL CB CG1 sing N N 237 VAL CB CG2 sing N N 238 VAL CB HB sing N N 239 VAL CG1 HG11 sing N N 240 VAL CG1 HG12 sing N N 241 VAL CG1 HG13 sing N N 242 VAL CG2 HG21 sing N N 243 VAL CG2 HG22 sing N N 244 VAL CG2 HG23 sing N N 245 VAL OXT HXT sing N N 246 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2JPK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ #