data_2JPR # _entry.id 2JPR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JPR pdb_00002jpr 10.2210/pdb2jpr/pdb RCSB RCSB100135 ? ? WWPDB D_1000100135 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.content_type 2PXR PDB 'HIV-1 CA146 in the presence of CAP-1' unspecified 2PWM PDB 'HIV-1 CA146 A92E Real Cell' unspecified 2PWO PDB 'HIV-1 CA146 A92E Psuedo Cell' unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JPR _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-05-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kelly, B.N.' 1 'Kyere, S.' 2 'Kinde, I.' 3 'Tang, C.' 4 'Howard, B.R.' 5 'Robinson, H.' 6 'Sundquist, W.I.' 7 'Summers, M.F.' 8 'Hill, C.P.' 9 # _citation.id primary _citation.title 'Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 373 _citation.page_first 355 _citation.page_last 366 _citation.year 2007 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17826792 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2007.07.070 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kelly, B.N.' 1 ? primary 'Kyere, S.' 2 ? primary 'Kinde, I.' 3 ? primary 'Tang, C.' 4 ? primary 'Howard, B.R.' 5 ? primary 'Robinson, H.' 6 ? primary 'Sundquist, W.I.' 7 ? primary 'Summers, M.F.' 8 ? primary 'Hill, C.P.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gag-Pol polyprotein' 16117.495 1 ? ? 'sequence database residues, 133-277' ? 2 non-polymer syn '1-(3-chloro-4-methylphenyl)-3-{2-[({5-[(dimethylamino)methyl]-2-furyl}methyl)thio]ethyl}urea' 381.920 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Pr160Gag-Pol # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEW DRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY ; _entity_poly.pdbx_seq_one_letter_code_can ;PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEW DRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ILE n 1 3 VAL n 1 4 GLN n 1 5 ASN n 1 6 LEU n 1 7 GLN n 1 8 GLY n 1 9 GLN n 1 10 MET n 1 11 VAL n 1 12 HIS n 1 13 GLN n 1 14 ALA n 1 15 ILE n 1 16 SER n 1 17 PRO n 1 18 ARG n 1 19 THR n 1 20 LEU n 1 21 ASN n 1 22 ALA n 1 23 TRP n 1 24 VAL n 1 25 LYS n 1 26 VAL n 1 27 VAL n 1 28 GLU n 1 29 GLU n 1 30 LYS n 1 31 ALA n 1 32 PHE n 1 33 SER n 1 34 PRO n 1 35 GLU n 1 36 VAL n 1 37 ILE n 1 38 PRO n 1 39 MET n 1 40 PHE n 1 41 SER n 1 42 ALA n 1 43 LEU n 1 44 SER n 1 45 GLU n 1 46 GLY n 1 47 ALA n 1 48 THR n 1 49 PRO n 1 50 GLN n 1 51 ASP n 1 52 LEU n 1 53 ASN n 1 54 THR n 1 55 MET n 1 56 LEU n 1 57 ASN n 1 58 THR n 1 59 VAL n 1 60 GLY n 1 61 GLY n 1 62 HIS n 1 63 GLN n 1 64 ALA n 1 65 ALA n 1 66 MET n 1 67 GLN n 1 68 MET n 1 69 LEU n 1 70 LYS n 1 71 GLU n 1 72 THR n 1 73 ILE n 1 74 ASN n 1 75 GLU n 1 76 GLU n 1 77 ALA n 1 78 ALA n 1 79 GLU n 1 80 TRP n 1 81 ASP n 1 82 ARG n 1 83 LEU n 1 84 HIS n 1 85 PRO n 1 86 VAL n 1 87 HIS n 1 88 ALA n 1 89 GLY n 1 90 PRO n 1 91 ILE n 1 92 ALA n 1 93 PRO n 1 94 GLY n 1 95 GLN n 1 96 MET n 1 97 ARG n 1 98 GLU n 1 99 PRO n 1 100 ARG n 1 101 GLY n 1 102 SER n 1 103 ASP n 1 104 ILE n 1 105 ALA n 1 106 GLY n 1 107 THR n 1 108 THR n 1 109 SER n 1 110 THR n 1 111 LEU n 1 112 GLN n 1 113 GLU n 1 114 GLN n 1 115 ILE n 1 116 GLY n 1 117 TRP n 1 118 MET n 1 119 THR n 1 120 HIS n 1 121 ASN n 1 122 PRO n 1 123 PRO n 1 124 ILE n 1 125 PRO n 1 126 VAL n 1 127 GLY n 1 128 GLU n 1 129 ILE n 1 130 TYR n 1 131 LYS n 1 132 ARG n 1 133 TRP n 1 134 ILE n 1 135 ILE n 1 136 LEU n 1 137 GLY n 1 138 LEU n 1 139 ASN n 1 140 LYS n 1 141 ILE n 1 142 VAL n 1 143 ARG n 1 144 MET n 1 145 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene gag-pol _entity_src_gen.gene_src_species 'Human immunodeficiency virus 1' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11698 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pln4-3 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.pdbx_db_accession P12497 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEW DRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY ; _struct_ref.pdbx_align_begin 133 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JPR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 145 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12497 _struct_ref_seq.db_align_beg 133 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 277 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 145 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JPR non-polymer . '1-(3-chloro-4-methylphenyl)-3-{2-[({5-[(dimethylamino)methyl]-2-furyl}methyl)thio]ethyl}urea' ? 'C18 H24 Cl N3 O2 S' 381.920 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '100-700 uM [U-15N] sodium phosphate, 100% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AMX 1 'Bruker AMX' 600 Bruker AMX 2 'Bruker AMX' # _pdbx_nmr_refine.entry_id 2JPR _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ;The structure of the "bound" conformation of the HIV-1 capsid protein (in the presence of the ligand) was obtained from the crystal. The complex was calculated using NMR distance restraints in reference to the bound conformation of the capsid protein. Refinement was performed using simulated molecular dynamics in AMBER 9.0. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2JPR _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2JPR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Koll' refinement Amber 9.0 1 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 2 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JPR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JPR _struct.title 'Joint refinement of the HIV-1 CA-NTD in complex with the assembly inhibitor CAP-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JPR _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'cap-1, capsid, HIV-1, assembly inhibitor, VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? ALA A 31 ? SER A 16 ALA A 31 1 ? 16 HELX_P HELX_P2 2 GLU A 35 ? LEU A 43 ? GLU A 35 LEU A 43 1 ? 9 HELX_P HELX_P3 3 THR A 48 ? THR A 58 ? THR A 48 THR A 58 1 ? 11 HELX_P HELX_P4 4 HIS A 62 ? HIS A 84 ? HIS A 62 HIS A 84 1 ? 23 HELX_P HELX_P5 5 ARG A 100 ? ALA A 105 ? ARG A 100 ALA A 105 1 ? 6 HELX_P HELX_P6 6 THR A 110 ? THR A 119 ? THR A 110 THR A 119 1 ? 10 HELX_P HELX_P7 7 PRO A 125 ? TYR A 145 ? PRO A 125 TYR A 145 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 1 -6.59 2 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 2 -6.77 3 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 3 -6.61 4 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 4 -6.64 5 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 5 -6.60 6 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 6 -6.66 7 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 7 -6.58 8 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 8 -6.68 9 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 9 -6.68 10 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 10 -6.64 11 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 11 -6.62 12 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 12 -6.62 13 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 13 -6.62 14 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 14 -6.64 15 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 15 -6.68 16 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 16 -6.60 17 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 17 -6.64 18 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 18 -6.65 19 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 19 -6.65 20 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 20 -6.69 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 2 ? GLN A 4 ? ILE A 2 GLN A 4 A 2 MET A 10 ? HIS A 12 ? MET A 10 HIS A 12 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 3 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 3 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 11 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 11 # _atom_sites.entry_id 2JPR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 MET 144 144 144 MET MET A . n A 1 145 TYR 145 145 145 TYR TYR A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id JPR _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 146 _pdbx_nonpoly_scheme.auth_seq_num 146 _pdbx_nonpoly_scheme.pdb_mon_id JPR _pdbx_nonpoly_scheme.auth_mon_id JPR _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' # _pdbx_nmr_exptl_sample.component 'sodium phosphate' _pdbx_nmr_exptl_sample.concentration 100 _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 TYR _pdbx_validate_rmsd_bond.auth_seq_id_1 145 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OXT _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 TYR _pdbx_validate_rmsd_bond.auth_seq_id_2 145 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.877 _pdbx_validate_rmsd_bond.bond_target_value 1.229 _pdbx_validate_rmsd_bond.bond_deviation 0.648 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 7 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 100 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.080 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '1-(3-chloro-4-methylphenyl)-3-{2-[({5-[(dimethylamino)methyl]-2-furyl}methyl)thio]ethyl}urea' _pdbx_entity_nonpoly.comp_id JPR #