data_2JPW # _entry.id 2JPW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JPW pdb_00002jpw 10.2210/pdb2jpw/pdb RCSB RCSB100140 ? ? WWPDB D_1000100140 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-12-11 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_conn 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JPW _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-05-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Howarth, J.W.' 1 'Rosevear, P.R.' 2 'Meller, J.' 3 'Solaro, R.J.' 4 'Trewhella, J.' 5 # _citation.id primary _citation.title 'Phosphorylation-dependent conformational transition of the cardiac specific N-extension of troponin I in cardiac troponin' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 373 _citation.page_first 706 _citation.page_last 722 _citation.year 2007 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17854829 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2007.08.035 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Howarth, J.W.' 1 ? primary 'Meller, J.' 2 ? primary 'Solaro, R.J.' 3 ? primary 'Trewhella, J.' 4 ? primary 'Rosevear, P.R.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Troponin I, cardiac muscle' _entity.formula_weight 3557.606 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-extension, residues 1-32' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cardiac troponin I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'MADESSDAAGEPQPAPAPVRRR(SEP)(SEP)ANYRAYAT' _entity_poly.pdbx_seq_one_letter_code_can MADESSDAAGEPQPAPAPVRRRSSANYRAYAT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 GLU n 1 5 SER n 1 6 SER n 1 7 ASP n 1 8 ALA n 1 9 ALA n 1 10 GLY n 1 11 GLU n 1 12 PRO n 1 13 GLN n 1 14 PRO n 1 15 ALA n 1 16 PRO n 1 17 ALA n 1 18 PRO n 1 19 VAL n 1 20 ARG n 1 21 ARG n 1 22 ARG n 1 23 SEP n 1 24 SEP n 1 25 ALA n 1 26 ASN n 1 27 TYR n 1 28 ARG n 1 29 ALA n 1 30 TYR n 1 31 ALA n 1 32 THR n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The protein is naturally in Mus Musculus (mouse).' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 SEP 23 23 23 SEP SEP A . n A 1 24 SEP 24 24 24 SEP SEP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 THR 32 32 32 THR THR A . n # _cell.entry_id 2JPW _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JPW _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JPW _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JPW _struct.title 'Solution structure of the bisphosphorylated cardiac specific N-extension of cardiac troponin I' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JPW _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text 'POLY (L-PROLINE) II HELIX, CONTRACTILE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNI3_MOUSE _struct_ref.pdbx_db_accession P48787 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MADESSDAAGEPQPAPAPVRRRSSANYRAYAT _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JPW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48787 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 32 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 10 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 10 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ARG 22 C ? ? ? 1_555 A SEP 23 N ? ? A ARG 22 A SEP 23 1_555 ? ? ? ? ? ? ? 1.310 ? ? covale2 covale both ? A SEP 23 C ? ? ? 1_555 A SEP 24 N ? ? A SEP 23 A SEP 24 1_555 ? ? ? ? ? ? ? 1.314 ? ? covale3 covale both ? A SEP 24 C ? ? ? 1_555 A ALA 25 N ? ? A SEP 24 A ALA 25 1_555 ? ? ? ? ? ? ? 1.314 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 9 ASP A 3 ? ? -100.71 -158.59 2 13 ALA A 2 ? ? -100.38 60.03 3 14 ALA A 2 ? ? -90.59 37.33 4 16 ASP A 3 ? ? -81.03 -145.64 5 16 GLU A 4 ? ? -91.00 36.76 6 20 GLU A 4 ? ? -101.66 56.11 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 20 ? ? 0.304 'SIDE CHAIN' 2 1 ARG A 21 ? ? 0.304 'SIDE CHAIN' 3 1 ARG A 22 ? ? 0.304 'SIDE CHAIN' 4 1 ARG A 28 ? ? 0.308 'SIDE CHAIN' 5 2 ARG A 20 ? ? 0.313 'SIDE CHAIN' 6 2 ARG A 21 ? ? 0.305 'SIDE CHAIN' 7 2 ARG A 22 ? ? 0.317 'SIDE CHAIN' 8 2 ARG A 28 ? ? 0.312 'SIDE CHAIN' 9 3 ARG A 20 ? ? 0.311 'SIDE CHAIN' 10 3 ARG A 21 ? ? 0.305 'SIDE CHAIN' 11 3 ARG A 22 ? ? 0.314 'SIDE CHAIN' 12 3 ARG A 28 ? ? 0.297 'SIDE CHAIN' 13 4 ARG A 20 ? ? 0.317 'SIDE CHAIN' 14 4 ARG A 21 ? ? 0.292 'SIDE CHAIN' 15 4 ARG A 22 ? ? 0.317 'SIDE CHAIN' 16 4 ARG A 28 ? ? 0.317 'SIDE CHAIN' 17 5 ARG A 20 ? ? 0.316 'SIDE CHAIN' 18 5 ARG A 21 ? ? 0.313 'SIDE CHAIN' 19 5 ARG A 22 ? ? 0.307 'SIDE CHAIN' 20 5 ARG A 28 ? ? 0.298 'SIDE CHAIN' 21 6 ARG A 20 ? ? 0.317 'SIDE CHAIN' 22 6 ARG A 21 ? ? 0.311 'SIDE CHAIN' 23 6 ARG A 22 ? ? 0.318 'SIDE CHAIN' 24 6 ARG A 28 ? ? 0.309 'SIDE CHAIN' 25 7 ARG A 20 ? ? 0.317 'SIDE CHAIN' 26 7 ARG A 21 ? ? 0.305 'SIDE CHAIN' 27 7 ARG A 22 ? ? 0.316 'SIDE CHAIN' 28 7 ARG A 28 ? ? 0.278 'SIDE CHAIN' 29 8 ARG A 20 ? ? 0.316 'SIDE CHAIN' 30 8 ARG A 21 ? ? 0.303 'SIDE CHAIN' 31 8 ARG A 22 ? ? 0.313 'SIDE CHAIN' 32 8 ARG A 28 ? ? 0.305 'SIDE CHAIN' 33 9 ARG A 20 ? ? 0.307 'SIDE CHAIN' 34 9 ARG A 21 ? ? 0.316 'SIDE CHAIN' 35 9 ARG A 22 ? ? 0.310 'SIDE CHAIN' 36 9 ARG A 28 ? ? 0.311 'SIDE CHAIN' 37 10 ARG A 20 ? ? 0.317 'SIDE CHAIN' 38 10 ARG A 21 ? ? 0.289 'SIDE CHAIN' 39 10 ARG A 22 ? ? 0.309 'SIDE CHAIN' 40 10 ARG A 28 ? ? 0.257 'SIDE CHAIN' 41 11 ARG A 20 ? ? 0.317 'SIDE CHAIN' 42 11 ARG A 21 ? ? 0.308 'SIDE CHAIN' 43 11 ARG A 22 ? ? 0.312 'SIDE CHAIN' 44 11 ARG A 28 ? ? 0.264 'SIDE CHAIN' 45 12 ARG A 20 ? ? 0.317 'SIDE CHAIN' 46 12 ARG A 21 ? ? 0.305 'SIDE CHAIN' 47 12 ARG A 22 ? ? 0.316 'SIDE CHAIN' 48 12 ARG A 28 ? ? 0.317 'SIDE CHAIN' 49 13 ARG A 20 ? ? 0.317 'SIDE CHAIN' 50 13 ARG A 21 ? ? 0.306 'SIDE CHAIN' 51 13 ARG A 22 ? ? 0.317 'SIDE CHAIN' 52 13 ARG A 28 ? ? 0.311 'SIDE CHAIN' 53 14 ARG A 20 ? ? 0.301 'SIDE CHAIN' 54 14 ARG A 21 ? ? 0.301 'SIDE CHAIN' 55 14 ARG A 22 ? ? 0.317 'SIDE CHAIN' 56 14 ARG A 28 ? ? 0.318 'SIDE CHAIN' 57 15 ARG A 20 ? ? 0.317 'SIDE CHAIN' 58 15 ARG A 21 ? ? 0.283 'SIDE CHAIN' 59 15 ARG A 22 ? ? 0.317 'SIDE CHAIN' 60 15 ARG A 28 ? ? 0.309 'SIDE CHAIN' 61 16 ARG A 20 ? ? 0.310 'SIDE CHAIN' 62 16 ARG A 21 ? ? 0.305 'SIDE CHAIN' 63 16 ARG A 22 ? ? 0.315 'SIDE CHAIN' 64 16 ARG A 28 ? ? 0.309 'SIDE CHAIN' 65 17 ARG A 20 ? ? 0.316 'SIDE CHAIN' 66 17 ARG A 21 ? ? 0.301 'SIDE CHAIN' 67 17 ARG A 22 ? ? 0.315 'SIDE CHAIN' 68 17 ARG A 28 ? ? 0.300 'SIDE CHAIN' 69 18 ARG A 20 ? ? 0.317 'SIDE CHAIN' 70 18 ARG A 21 ? ? 0.273 'SIDE CHAIN' 71 18 ARG A 22 ? ? 0.317 'SIDE CHAIN' 72 18 ARG A 28 ? ? 0.314 'SIDE CHAIN' 73 19 ARG A 20 ? ? 0.309 'SIDE CHAIN' 74 19 ARG A 21 ? ? 0.313 'SIDE CHAIN' 75 19 ARG A 22 ? ? 0.317 'SIDE CHAIN' 76 19 ARG A 28 ? ? 0.312 'SIDE CHAIN' 77 20 ARG A 20 ? ? 0.316 'SIDE CHAIN' 78 20 ARG A 21 ? ? 0.284 'SIDE CHAIN' 79 20 ARG A 22 ? ? 0.301 'SIDE CHAIN' 80 20 ARG A 28 ? ? 0.318 'SIDE CHAIN' # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A SEP 23 A SEP 23 ? SER PHOSPHOSERINE 2 A SEP 24 A SEP 24 ? SER PHOSPHOSERINE # _pdbx_nmr_ensemble.entry_id 2JPW _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2JPW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '5 mM mM troponin I (1-32) PP, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component 'troponin I (1-32) PP' _pdbx_nmr_exptl_sample.concentration 5 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 283 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '2D DQF-COSY' # _pdbx_nmr_refine.entry_id 2JPW _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 362 restraints, 283 are NOE-derived distance constraints, 75 dihedral angle restraints, 4 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Accelrys Software Inc.' processing Felix 2000 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.9.6 2 Goddard 'data analysis' Sparky 3.110 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 MET N N N N 123 MET CA C N S 124 MET C C N N 125 MET O O N N 126 MET CB C N N 127 MET CG C N N 128 MET SD S N N 129 MET CE C N N 130 MET OXT O N N 131 MET H H N N 132 MET H2 H N N 133 MET HA H N N 134 MET HB2 H N N 135 MET HB3 H N N 136 MET HG2 H N N 137 MET HG3 H N N 138 MET HE1 H N N 139 MET HE2 H N N 140 MET HE3 H N N 141 MET HXT H N N 142 PRO N N N N 143 PRO CA C N S 144 PRO C C N N 145 PRO O O N N 146 PRO CB C N N 147 PRO CG C N N 148 PRO CD C N N 149 PRO OXT O N N 150 PRO H H N N 151 PRO HA H N N 152 PRO HB2 H N N 153 PRO HB3 H N N 154 PRO HG2 H N N 155 PRO HG3 H N N 156 PRO HD2 H N N 157 PRO HD3 H N N 158 PRO HXT H N N 159 SEP N N N N 160 SEP CA C N S 161 SEP CB C N N 162 SEP OG O N N 163 SEP C C N N 164 SEP O O N N 165 SEP OXT O N N 166 SEP P P N N 167 SEP O1P O N N 168 SEP O2P O N N 169 SEP O3P O N N 170 SEP H H N N 171 SEP H2 H N N 172 SEP HA H N N 173 SEP HB2 H N N 174 SEP HB3 H N N 175 SEP HXT H N N 176 SEP HOP2 H N N 177 SEP HOP3 H N N 178 SER N N N N 179 SER CA C N S 180 SER C C N N 181 SER O O N N 182 SER CB C N N 183 SER OG O N N 184 SER OXT O N N 185 SER H H N N 186 SER H2 H N N 187 SER HA H N N 188 SER HB2 H N N 189 SER HB3 H N N 190 SER HG H N N 191 SER HXT H N N 192 THR N N N N 193 THR CA C N S 194 THR C C N N 195 THR O O N N 196 THR CB C N R 197 THR OG1 O N N 198 THR CG2 C N N 199 THR OXT O N N 200 THR H H N N 201 THR H2 H N N 202 THR HA H N N 203 THR HB H N N 204 THR HG1 H N N 205 THR HG21 H N N 206 THR HG22 H N N 207 THR HG23 H N N 208 THR HXT H N N 209 TYR N N N N 210 TYR CA C N S 211 TYR C C N N 212 TYR O O N N 213 TYR CB C N N 214 TYR CG C Y N 215 TYR CD1 C Y N 216 TYR CD2 C Y N 217 TYR CE1 C Y N 218 TYR CE2 C Y N 219 TYR CZ C Y N 220 TYR OH O N N 221 TYR OXT O N N 222 TYR H H N N 223 TYR H2 H N N 224 TYR HA H N N 225 TYR HB2 H N N 226 TYR HB3 H N N 227 TYR HD1 H N N 228 TYR HD2 H N N 229 TYR HE1 H N N 230 TYR HE2 H N N 231 TYR HH H N N 232 TYR HXT H N N 233 VAL N N N N 234 VAL CA C N S 235 VAL C C N N 236 VAL O O N N 237 VAL CB C N N 238 VAL CG1 C N N 239 VAL CG2 C N N 240 VAL OXT O N N 241 VAL H H N N 242 VAL H2 H N N 243 VAL HA H N N 244 VAL HB H N N 245 VAL HG11 H N N 246 VAL HG12 H N N 247 VAL HG13 H N N 248 VAL HG21 H N N 249 VAL HG22 H N N 250 VAL HG23 H N N 251 VAL HXT H N N 252 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 MET N CA sing N N 116 MET N H sing N N 117 MET N H2 sing N N 118 MET CA C sing N N 119 MET CA CB sing N N 120 MET CA HA sing N N 121 MET C O doub N N 122 MET C OXT sing N N 123 MET CB CG sing N N 124 MET CB HB2 sing N N 125 MET CB HB3 sing N N 126 MET CG SD sing N N 127 MET CG HG2 sing N N 128 MET CG HG3 sing N N 129 MET SD CE sing N N 130 MET CE HE1 sing N N 131 MET CE HE2 sing N N 132 MET CE HE3 sing N N 133 MET OXT HXT sing N N 134 PRO N CA sing N N 135 PRO N CD sing N N 136 PRO N H sing N N 137 PRO CA C sing N N 138 PRO CA CB sing N N 139 PRO CA HA sing N N 140 PRO C O doub N N 141 PRO C OXT sing N N 142 PRO CB CG sing N N 143 PRO CB HB2 sing N N 144 PRO CB HB3 sing N N 145 PRO CG CD sing N N 146 PRO CG HG2 sing N N 147 PRO CG HG3 sing N N 148 PRO CD HD2 sing N N 149 PRO CD HD3 sing N N 150 PRO OXT HXT sing N N 151 SEP N CA sing N N 152 SEP N H sing N N 153 SEP N H2 sing N N 154 SEP CA CB sing N N 155 SEP CA C sing N N 156 SEP CA HA sing N N 157 SEP CB OG sing N N 158 SEP CB HB2 sing N N 159 SEP CB HB3 sing N N 160 SEP OG P sing N N 161 SEP C O doub N N 162 SEP C OXT sing N N 163 SEP OXT HXT sing N N 164 SEP P O1P doub N N 165 SEP P O2P sing N N 166 SEP P O3P sing N N 167 SEP O2P HOP2 sing N N 168 SEP O3P HOP3 sing N N 169 SER N CA sing N N 170 SER N H sing N N 171 SER N H2 sing N N 172 SER CA C sing N N 173 SER CA CB sing N N 174 SER CA HA sing N N 175 SER C O doub N N 176 SER C OXT sing N N 177 SER CB OG sing N N 178 SER CB HB2 sing N N 179 SER CB HB3 sing N N 180 SER OG HG sing N N 181 SER OXT HXT sing N N 182 THR N CA sing N N 183 THR N H sing N N 184 THR N H2 sing N N 185 THR CA C sing N N 186 THR CA CB sing N N 187 THR CA HA sing N N 188 THR C O doub N N 189 THR C OXT sing N N 190 THR CB OG1 sing N N 191 THR CB CG2 sing N N 192 THR CB HB sing N N 193 THR OG1 HG1 sing N N 194 THR CG2 HG21 sing N N 195 THR CG2 HG22 sing N N 196 THR CG2 HG23 sing N N 197 THR OXT HXT sing N N 198 TYR N CA sing N N 199 TYR N H sing N N 200 TYR N H2 sing N N 201 TYR CA C sing N N 202 TYR CA CB sing N N 203 TYR CA HA sing N N 204 TYR C O doub N N 205 TYR C OXT sing N N 206 TYR CB CG sing N N 207 TYR CB HB2 sing N N 208 TYR CB HB3 sing N N 209 TYR CG CD1 doub Y N 210 TYR CG CD2 sing Y N 211 TYR CD1 CE1 sing Y N 212 TYR CD1 HD1 sing N N 213 TYR CD2 CE2 doub Y N 214 TYR CD2 HD2 sing N N 215 TYR CE1 CZ doub Y N 216 TYR CE1 HE1 sing N N 217 TYR CE2 CZ sing Y N 218 TYR CE2 HE2 sing N N 219 TYR CZ OH sing N N 220 TYR OH HH sing N N 221 TYR OXT HXT sing N N 222 VAL N CA sing N N 223 VAL N H sing N N 224 VAL N H2 sing N N 225 VAL CA C sing N N 226 VAL CA CB sing N N 227 VAL CA HA sing N N 228 VAL C O doub N N 229 VAL C OXT sing N N 230 VAL CB CG1 sing N N 231 VAL CB CG2 sing N N 232 VAL CB HB sing N N 233 VAL CG1 HG11 sing N N 234 VAL CG1 HG12 sing N N 235 VAL CG1 HG13 sing N N 236 VAL CG2 HG21 sing N N 237 VAL CG2 HG22 sing N N 238 VAL CG2 HG23 sing N N 239 VAL OXT HXT sing N N 240 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2JPW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_