data_2JQH # _entry.id 2JQH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JQH pdb_00002jqh 10.2210/pdb2jqh/pdb RCSB RCSB100161 ? ? WWPDB D_1000100161 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JQH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2JQK _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stuchell-Brereton, M.D.' 1 'Skalicky, J.J.' 2 'Kieffer, C.' 3 'Ghaffarian, S.' 4 'Sundquist, W.I.' 5 # _citation.id primary _citation.title 'ESCRT-III recognition by VPS4 ATPases.' _citation.journal_abbrev Nature _citation.journal_volume 449 _citation.page_first 740 _citation.page_last 744 _citation.year 2007 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17928862 _citation.pdbx_database_id_DOI 10.1038/nature06172 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stuchell-Brereton, M.D.' 1 ? primary 'Skalicky, J.J.' 2 ? primary 'Kieffer, C.' 3 ? primary 'Karren, M.A.' 4 ? primary 'Ghaffarian, S.' 5 ? primary 'Sundquist, W.I.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Vacuolar protein sorting-associating protein 4B' _entity.formula_weight 10192.597 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'MIT domain, residues 1-86' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Suppressor of K+, transport growth defect 1, Protein SKD1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLK NKEKKAQKP ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLK NKEKKAQKP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 MET n 1 5 SER n 1 6 SER n 1 7 THR n 1 8 SER n 1 9 PRO n 1 10 ASN n 1 11 LEU n 1 12 GLN n 1 13 LYS n 1 14 ALA n 1 15 ILE n 1 16 ASP n 1 17 LEU n 1 18 ALA n 1 19 SER n 1 20 LYS n 1 21 ALA n 1 22 ALA n 1 23 GLN n 1 24 GLU n 1 25 ASP n 1 26 LYS n 1 27 ALA n 1 28 GLY n 1 29 ASN n 1 30 TYR n 1 31 GLU n 1 32 GLU n 1 33 ALA n 1 34 LEU n 1 35 GLN n 1 36 LEU n 1 37 TYR n 1 38 GLN n 1 39 HIS n 1 40 ALA n 1 41 VAL n 1 42 GLN n 1 43 TYR n 1 44 PHE n 1 45 LEU n 1 46 HIS n 1 47 VAL n 1 48 VAL n 1 49 LYS n 1 50 TYR n 1 51 GLU n 1 52 ALA n 1 53 GLN n 1 54 GLY n 1 55 ASP n 1 56 LYS n 1 57 ALA n 1 58 LYS n 1 59 GLN n 1 60 SER n 1 61 ILE n 1 62 ARG n 1 63 ALA n 1 64 LYS n 1 65 CYS n 1 66 THR n 1 67 GLU n 1 68 TYR n 1 69 LEU n 1 70 ASP n 1 71 ARG n 1 72 ALA n 1 73 GLU n 1 74 LYS n 1 75 LEU n 1 76 LYS n 1 77 GLU n 1 78 TYR n 1 79 LEU n 1 80 LYS n 1 81 ASN n 1 82 LYS n 1 83 GLU n 1 84 LYS n 1 85 LYS n 1 86 ALA n 1 87 GLN n 1 88 LYS n 1 89 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'VPS4B, SKD1, VPS42' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET16b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 HIS 2 2 ? ? ? A . n A 1 3 MET 3 3 ? ? ? A . n A 1 4 MET 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 LYS 82 82 ? ? ? A . n A 1 83 GLU 83 83 ? ? ? A . n A 1 84 LYS 84 84 ? ? ? A . n A 1 85 LYS 85 85 ? ? ? A . n A 1 86 ALA 86 86 ? ? ? A . n A 1 87 GLN 87 87 ? ? ? A . n A 1 88 LYS 88 88 ? ? ? A . n A 1 89 PRO 89 89 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JQH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JQH _struct.title 'VPS4B MIT' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JQH _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text 'VPS4B, MIT, Three Helix Bundle, PROTEIN TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VPS4B_HUMAN _struct_ref.pdbx_db_accession O75351 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKE KKAQKP ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JQH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75351 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JQH GLY A 1 ? UNP O75351 ? ? 'expression tag' 1 1 1 2JQH HIS A 2 ? UNP O75351 ? ? 'expression tag' 2 2 1 2JQH MET A 3 ? UNP O75351 ? ? 'expression tag' 3 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 10 ? GLY A 28 ? ASN A 10 GLY A 28 1 ? 19 HELX_P HELX_P2 2 TYR A 30 ? ALA A 52 ? TYR A 30 ALA A 52 1 ? 23 HELX_P HELX_P3 3 GLY A 54 ? ASN A 81 ? GLY A 54 ASN A 81 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 50 ? ? -71.74 -73.52 2 1 ALA A 52 ? ? -69.79 -177.10 3 2 GLU A 51 ? ? -168.16 101.28 4 3 TYR A 50 ? ? -80.93 -73.55 5 3 GLU A 51 ? ? -160.20 97.52 6 4 TYR A 50 ? ? -87.11 -71.34 7 4 GLU A 51 ? ? -163.86 95.31 8 5 GLU A 51 ? ? -167.28 96.41 9 5 ALA A 52 ? ? -65.53 -169.85 10 6 TYR A 50 ? ? -78.11 -73.74 11 6 GLU A 51 ? ? -161.85 98.35 12 6 ALA A 52 ? ? -67.23 -169.85 13 7 TYR A 50 ? ? -104.29 -61.59 14 7 GLU A 51 ? ? -176.61 105.11 15 8 TYR A 50 ? ? -78.98 -72.19 16 8 GLU A 51 ? ? -166.36 98.86 17 8 ALA A 52 ? ? -71.63 -169.91 18 9 TYR A 50 ? ? -60.32 -73.85 19 9 GLU A 51 ? ? -165.06 91.22 20 9 ALA A 52 ? ? -60.13 -176.03 21 10 TYR A 50 ? ? -103.38 -66.22 22 10 ALA A 52 ? ? -66.11 -169.80 23 11 TYR A 50 ? ? -67.56 -73.20 24 11 GLU A 51 ? ? -164.20 94.60 25 11 ALA A 52 ? ? -62.84 -176.03 26 12 ASN A 29 ? ? -57.15 93.46 27 12 GLU A 51 ? ? -169.37 92.78 28 12 ALA A 52 ? ? -59.64 -169.79 29 12 ASP A 55 ? ? -125.60 -59.72 30 13 TYR A 50 ? ? -74.91 -73.69 31 13 GLU A 51 ? ? -160.89 95.94 32 13 ALA A 52 ? ? -67.48 -176.10 33 14 GLU A 51 ? ? -173.60 90.79 34 14 ALA A 52 ? ? -64.01 -178.12 35 15 TYR A 50 ? ? -77.56 -73.47 36 15 GLU A 51 ? ? -161.61 94.58 37 15 ALA A 52 ? ? -66.28 -176.05 38 16 TYR A 50 ? ? -72.67 -71.12 39 16 GLU A 51 ? ? -165.75 92.51 40 16 ALA A 52 ? ? -59.85 -176.05 41 17 TYR A 50 ? ? -87.56 -72.48 42 17 GLU A 51 ? ? -162.47 97.85 43 17 ALA A 52 ? ? -72.23 -169.84 44 18 TYR A 50 ? ? -71.37 -73.77 45 18 GLU A 51 ? ? -168.09 96.25 46 18 ALA A 52 ? ? -60.07 -171.08 47 19 GLU A 51 ? ? -171.96 99.37 48 20 GLU A 51 ? ? -169.22 94.26 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.03 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JQH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 0.1 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.065 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method CNS # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.004 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2JQH _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JQH _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1.8 mM [U-100% 13C; U-100% 15N] VPS4B MIT, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component 'VPS4B MIT' _pdbx_nmr_exptl_sample.concentration 1.8 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 5.65 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCACB' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D HNHA' 1 7 1 '3D C(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HCCH-COSY' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D 1H-13C NOESY' 1 12 1 '3D 1H-15N NOESY' # _pdbx_nmr_details.entry_id 2JQH _pdbx_nmr_details.text 'Half-filtered NOESYs provided the intermolecular NOEs' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JQH _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 55 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1769 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 426 _pdbx_nmr_constraints.NOE_long_range_total_count 387 _pdbx_nmr_constraints.NOE_medium_range_total_count 538 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 418 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 60 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 60 # _pdbx_nmr_refine.entry_id 2JQH _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Refinement using anneal.inp and using summed NOE constraints with max T of 3000 K for simulated annealing.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Accelrys Software Inc.' processing Felix 2004 1 Goddard 'chemical shift assignment' Sparky 3.112 2 Goddard 'peak picking' Sparky 3.112 3 Goddard 'data analysis' Sparky 3.112 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A HIS 2 ? A HIS 2 3 1 Y 1 A MET 3 ? A MET 3 4 1 Y 1 A MET 4 ? A MET 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A LYS 82 ? A LYS 82 11 1 Y 1 A GLU 83 ? A GLU 83 12 1 Y 1 A LYS 84 ? A LYS 84 13 1 Y 1 A LYS 85 ? A LYS 85 14 1 Y 1 A ALA 86 ? A ALA 86 15 1 Y 1 A GLN 87 ? A GLN 87 16 1 Y 1 A LYS 88 ? A LYS 88 17 1 Y 1 A PRO 89 ? A PRO 89 18 2 Y 1 A GLY 1 ? A GLY 1 19 2 Y 1 A HIS 2 ? A HIS 2 20 2 Y 1 A MET 3 ? A MET 3 21 2 Y 1 A MET 4 ? A MET 4 22 2 Y 1 A SER 5 ? A SER 5 23 2 Y 1 A SER 6 ? A SER 6 24 2 Y 1 A THR 7 ? A THR 7 25 2 Y 1 A SER 8 ? A SER 8 26 2 Y 1 A PRO 9 ? A PRO 9 27 2 Y 1 A LYS 82 ? A LYS 82 28 2 Y 1 A GLU 83 ? A GLU 83 29 2 Y 1 A LYS 84 ? A LYS 84 30 2 Y 1 A LYS 85 ? A LYS 85 31 2 Y 1 A ALA 86 ? A ALA 86 32 2 Y 1 A GLN 87 ? A GLN 87 33 2 Y 1 A LYS 88 ? A LYS 88 34 2 Y 1 A PRO 89 ? A PRO 89 35 3 Y 1 A GLY 1 ? A GLY 1 36 3 Y 1 A HIS 2 ? A HIS 2 37 3 Y 1 A MET 3 ? A MET 3 38 3 Y 1 A MET 4 ? A MET 4 39 3 Y 1 A SER 5 ? A SER 5 40 3 Y 1 A SER 6 ? A SER 6 41 3 Y 1 A THR 7 ? A THR 7 42 3 Y 1 A SER 8 ? A SER 8 43 3 Y 1 A PRO 9 ? A PRO 9 44 3 Y 1 A LYS 82 ? A LYS 82 45 3 Y 1 A GLU 83 ? A GLU 83 46 3 Y 1 A LYS 84 ? A LYS 84 47 3 Y 1 A LYS 85 ? A LYS 85 48 3 Y 1 A ALA 86 ? A ALA 86 49 3 Y 1 A GLN 87 ? A GLN 87 50 3 Y 1 A LYS 88 ? A LYS 88 51 3 Y 1 A PRO 89 ? A PRO 89 52 4 Y 1 A GLY 1 ? A GLY 1 53 4 Y 1 A HIS 2 ? A HIS 2 54 4 Y 1 A MET 3 ? A MET 3 55 4 Y 1 A MET 4 ? A MET 4 56 4 Y 1 A SER 5 ? A SER 5 57 4 Y 1 A SER 6 ? A SER 6 58 4 Y 1 A THR 7 ? A THR 7 59 4 Y 1 A SER 8 ? A SER 8 60 4 Y 1 A PRO 9 ? A PRO 9 61 4 Y 1 A LYS 82 ? A LYS 82 62 4 Y 1 A GLU 83 ? A GLU 83 63 4 Y 1 A LYS 84 ? A LYS 84 64 4 Y 1 A LYS 85 ? A LYS 85 65 4 Y 1 A ALA 86 ? A ALA 86 66 4 Y 1 A GLN 87 ? A GLN 87 67 4 Y 1 A LYS 88 ? A LYS 88 68 4 Y 1 A PRO 89 ? A PRO 89 69 5 Y 1 A GLY 1 ? A GLY 1 70 5 Y 1 A HIS 2 ? A HIS 2 71 5 Y 1 A MET 3 ? A MET 3 72 5 Y 1 A MET 4 ? A MET 4 73 5 Y 1 A SER 5 ? A SER 5 74 5 Y 1 A SER 6 ? A SER 6 75 5 Y 1 A THR 7 ? A THR 7 76 5 Y 1 A SER 8 ? A SER 8 77 5 Y 1 A PRO 9 ? A PRO 9 78 5 Y 1 A LYS 82 ? A LYS 82 79 5 Y 1 A GLU 83 ? A GLU 83 80 5 Y 1 A LYS 84 ? A LYS 84 81 5 Y 1 A LYS 85 ? A LYS 85 82 5 Y 1 A ALA 86 ? A ALA 86 83 5 Y 1 A GLN 87 ? A GLN 87 84 5 Y 1 A LYS 88 ? A LYS 88 85 5 Y 1 A PRO 89 ? A PRO 89 86 6 Y 1 A GLY 1 ? A GLY 1 87 6 Y 1 A HIS 2 ? A HIS 2 88 6 Y 1 A MET 3 ? A MET 3 89 6 Y 1 A MET 4 ? A MET 4 90 6 Y 1 A SER 5 ? A SER 5 91 6 Y 1 A SER 6 ? A SER 6 92 6 Y 1 A THR 7 ? A THR 7 93 6 Y 1 A SER 8 ? A SER 8 94 6 Y 1 A PRO 9 ? A PRO 9 95 6 Y 1 A LYS 82 ? A LYS 82 96 6 Y 1 A GLU 83 ? A GLU 83 97 6 Y 1 A LYS 84 ? A LYS 84 98 6 Y 1 A LYS 85 ? A LYS 85 99 6 Y 1 A ALA 86 ? A ALA 86 100 6 Y 1 A GLN 87 ? A GLN 87 101 6 Y 1 A LYS 88 ? A LYS 88 102 6 Y 1 A PRO 89 ? A PRO 89 103 7 Y 1 A GLY 1 ? A GLY 1 104 7 Y 1 A HIS 2 ? A HIS 2 105 7 Y 1 A MET 3 ? A MET 3 106 7 Y 1 A MET 4 ? A MET 4 107 7 Y 1 A SER 5 ? A SER 5 108 7 Y 1 A SER 6 ? A SER 6 109 7 Y 1 A THR 7 ? A THR 7 110 7 Y 1 A SER 8 ? A SER 8 111 7 Y 1 A PRO 9 ? A PRO 9 112 7 Y 1 A LYS 82 ? A LYS 82 113 7 Y 1 A GLU 83 ? A GLU 83 114 7 Y 1 A LYS 84 ? A LYS 84 115 7 Y 1 A LYS 85 ? A LYS 85 116 7 Y 1 A ALA 86 ? A ALA 86 117 7 Y 1 A GLN 87 ? A GLN 87 118 7 Y 1 A LYS 88 ? A LYS 88 119 7 Y 1 A PRO 89 ? A PRO 89 120 8 Y 1 A GLY 1 ? A GLY 1 121 8 Y 1 A HIS 2 ? A HIS 2 122 8 Y 1 A MET 3 ? A MET 3 123 8 Y 1 A MET 4 ? A MET 4 124 8 Y 1 A SER 5 ? A SER 5 125 8 Y 1 A SER 6 ? A SER 6 126 8 Y 1 A THR 7 ? A THR 7 127 8 Y 1 A SER 8 ? A SER 8 128 8 Y 1 A PRO 9 ? A PRO 9 129 8 Y 1 A LYS 82 ? A LYS 82 130 8 Y 1 A GLU 83 ? A GLU 83 131 8 Y 1 A LYS 84 ? A LYS 84 132 8 Y 1 A LYS 85 ? A LYS 85 133 8 Y 1 A ALA 86 ? A ALA 86 134 8 Y 1 A GLN 87 ? A GLN 87 135 8 Y 1 A LYS 88 ? A LYS 88 136 8 Y 1 A PRO 89 ? A PRO 89 137 9 Y 1 A GLY 1 ? A GLY 1 138 9 Y 1 A HIS 2 ? A HIS 2 139 9 Y 1 A MET 3 ? A MET 3 140 9 Y 1 A MET 4 ? A MET 4 141 9 Y 1 A SER 5 ? A SER 5 142 9 Y 1 A SER 6 ? A SER 6 143 9 Y 1 A THR 7 ? A THR 7 144 9 Y 1 A SER 8 ? A SER 8 145 9 Y 1 A PRO 9 ? A PRO 9 146 9 Y 1 A LYS 82 ? A LYS 82 147 9 Y 1 A GLU 83 ? A GLU 83 148 9 Y 1 A LYS 84 ? A LYS 84 149 9 Y 1 A LYS 85 ? A LYS 85 150 9 Y 1 A ALA 86 ? A ALA 86 151 9 Y 1 A GLN 87 ? A GLN 87 152 9 Y 1 A LYS 88 ? A LYS 88 153 9 Y 1 A PRO 89 ? A PRO 89 154 10 Y 1 A GLY 1 ? A GLY 1 155 10 Y 1 A HIS 2 ? A HIS 2 156 10 Y 1 A MET 3 ? A MET 3 157 10 Y 1 A MET 4 ? A MET 4 158 10 Y 1 A SER 5 ? A SER 5 159 10 Y 1 A SER 6 ? A SER 6 160 10 Y 1 A THR 7 ? A THR 7 161 10 Y 1 A SER 8 ? A SER 8 162 10 Y 1 A PRO 9 ? A PRO 9 163 10 Y 1 A LYS 82 ? A LYS 82 164 10 Y 1 A GLU 83 ? A GLU 83 165 10 Y 1 A LYS 84 ? A LYS 84 166 10 Y 1 A LYS 85 ? A LYS 85 167 10 Y 1 A ALA 86 ? A ALA 86 168 10 Y 1 A GLN 87 ? A GLN 87 169 10 Y 1 A LYS 88 ? A LYS 88 170 10 Y 1 A PRO 89 ? A PRO 89 171 11 Y 1 A GLY 1 ? A GLY 1 172 11 Y 1 A HIS 2 ? A HIS 2 173 11 Y 1 A MET 3 ? A MET 3 174 11 Y 1 A MET 4 ? A MET 4 175 11 Y 1 A SER 5 ? A SER 5 176 11 Y 1 A SER 6 ? A SER 6 177 11 Y 1 A THR 7 ? A THR 7 178 11 Y 1 A SER 8 ? A SER 8 179 11 Y 1 A PRO 9 ? A PRO 9 180 11 Y 1 A LYS 82 ? A LYS 82 181 11 Y 1 A GLU 83 ? A GLU 83 182 11 Y 1 A LYS 84 ? A LYS 84 183 11 Y 1 A LYS 85 ? A LYS 85 184 11 Y 1 A ALA 86 ? A ALA 86 185 11 Y 1 A GLN 87 ? A GLN 87 186 11 Y 1 A LYS 88 ? A LYS 88 187 11 Y 1 A PRO 89 ? A PRO 89 188 12 Y 1 A GLY 1 ? A GLY 1 189 12 Y 1 A HIS 2 ? A HIS 2 190 12 Y 1 A MET 3 ? A MET 3 191 12 Y 1 A MET 4 ? A MET 4 192 12 Y 1 A SER 5 ? A SER 5 193 12 Y 1 A SER 6 ? A SER 6 194 12 Y 1 A THR 7 ? A THR 7 195 12 Y 1 A SER 8 ? A SER 8 196 12 Y 1 A PRO 9 ? A PRO 9 197 12 Y 1 A LYS 82 ? A LYS 82 198 12 Y 1 A GLU 83 ? A GLU 83 199 12 Y 1 A LYS 84 ? A LYS 84 200 12 Y 1 A LYS 85 ? A LYS 85 201 12 Y 1 A ALA 86 ? A ALA 86 202 12 Y 1 A GLN 87 ? A GLN 87 203 12 Y 1 A LYS 88 ? A LYS 88 204 12 Y 1 A PRO 89 ? A PRO 89 205 13 Y 1 A GLY 1 ? A GLY 1 206 13 Y 1 A HIS 2 ? A HIS 2 207 13 Y 1 A MET 3 ? A MET 3 208 13 Y 1 A MET 4 ? A MET 4 209 13 Y 1 A SER 5 ? A SER 5 210 13 Y 1 A SER 6 ? A SER 6 211 13 Y 1 A THR 7 ? A THR 7 212 13 Y 1 A SER 8 ? A SER 8 213 13 Y 1 A PRO 9 ? A PRO 9 214 13 Y 1 A LYS 82 ? A LYS 82 215 13 Y 1 A GLU 83 ? A GLU 83 216 13 Y 1 A LYS 84 ? A LYS 84 217 13 Y 1 A LYS 85 ? A LYS 85 218 13 Y 1 A ALA 86 ? A ALA 86 219 13 Y 1 A GLN 87 ? A GLN 87 220 13 Y 1 A LYS 88 ? A LYS 88 221 13 Y 1 A PRO 89 ? A PRO 89 222 14 Y 1 A GLY 1 ? A GLY 1 223 14 Y 1 A HIS 2 ? A HIS 2 224 14 Y 1 A MET 3 ? A MET 3 225 14 Y 1 A MET 4 ? A MET 4 226 14 Y 1 A SER 5 ? A SER 5 227 14 Y 1 A SER 6 ? A SER 6 228 14 Y 1 A THR 7 ? A THR 7 229 14 Y 1 A SER 8 ? A SER 8 230 14 Y 1 A PRO 9 ? A PRO 9 231 14 Y 1 A LYS 82 ? A LYS 82 232 14 Y 1 A GLU 83 ? A GLU 83 233 14 Y 1 A LYS 84 ? A LYS 84 234 14 Y 1 A LYS 85 ? A LYS 85 235 14 Y 1 A ALA 86 ? A ALA 86 236 14 Y 1 A GLN 87 ? A GLN 87 237 14 Y 1 A LYS 88 ? A LYS 88 238 14 Y 1 A PRO 89 ? A PRO 89 239 15 Y 1 A GLY 1 ? A GLY 1 240 15 Y 1 A HIS 2 ? A HIS 2 241 15 Y 1 A MET 3 ? A MET 3 242 15 Y 1 A MET 4 ? A MET 4 243 15 Y 1 A SER 5 ? A SER 5 244 15 Y 1 A SER 6 ? A SER 6 245 15 Y 1 A THR 7 ? A THR 7 246 15 Y 1 A SER 8 ? A SER 8 247 15 Y 1 A PRO 9 ? A PRO 9 248 15 Y 1 A LYS 82 ? A LYS 82 249 15 Y 1 A GLU 83 ? A GLU 83 250 15 Y 1 A LYS 84 ? A LYS 84 251 15 Y 1 A LYS 85 ? A LYS 85 252 15 Y 1 A ALA 86 ? A ALA 86 253 15 Y 1 A GLN 87 ? A GLN 87 254 15 Y 1 A LYS 88 ? A LYS 88 255 15 Y 1 A PRO 89 ? A PRO 89 256 16 Y 1 A GLY 1 ? A GLY 1 257 16 Y 1 A HIS 2 ? A HIS 2 258 16 Y 1 A MET 3 ? A MET 3 259 16 Y 1 A MET 4 ? A MET 4 260 16 Y 1 A SER 5 ? A SER 5 261 16 Y 1 A SER 6 ? A SER 6 262 16 Y 1 A THR 7 ? A THR 7 263 16 Y 1 A SER 8 ? A SER 8 264 16 Y 1 A PRO 9 ? A PRO 9 265 16 Y 1 A LYS 82 ? A LYS 82 266 16 Y 1 A GLU 83 ? A GLU 83 267 16 Y 1 A LYS 84 ? A LYS 84 268 16 Y 1 A LYS 85 ? A LYS 85 269 16 Y 1 A ALA 86 ? A ALA 86 270 16 Y 1 A GLN 87 ? A GLN 87 271 16 Y 1 A LYS 88 ? A LYS 88 272 16 Y 1 A PRO 89 ? A PRO 89 273 17 Y 1 A GLY 1 ? A GLY 1 274 17 Y 1 A HIS 2 ? A HIS 2 275 17 Y 1 A MET 3 ? A MET 3 276 17 Y 1 A MET 4 ? A MET 4 277 17 Y 1 A SER 5 ? A SER 5 278 17 Y 1 A SER 6 ? A SER 6 279 17 Y 1 A THR 7 ? A THR 7 280 17 Y 1 A SER 8 ? A SER 8 281 17 Y 1 A PRO 9 ? A PRO 9 282 17 Y 1 A LYS 82 ? A LYS 82 283 17 Y 1 A GLU 83 ? A GLU 83 284 17 Y 1 A LYS 84 ? A LYS 84 285 17 Y 1 A LYS 85 ? A LYS 85 286 17 Y 1 A ALA 86 ? A ALA 86 287 17 Y 1 A GLN 87 ? A GLN 87 288 17 Y 1 A LYS 88 ? A LYS 88 289 17 Y 1 A PRO 89 ? A PRO 89 290 18 Y 1 A GLY 1 ? A GLY 1 291 18 Y 1 A HIS 2 ? A HIS 2 292 18 Y 1 A MET 3 ? A MET 3 293 18 Y 1 A MET 4 ? A MET 4 294 18 Y 1 A SER 5 ? A SER 5 295 18 Y 1 A SER 6 ? A SER 6 296 18 Y 1 A THR 7 ? A THR 7 297 18 Y 1 A SER 8 ? A SER 8 298 18 Y 1 A PRO 9 ? A PRO 9 299 18 Y 1 A LYS 82 ? A LYS 82 300 18 Y 1 A GLU 83 ? A GLU 83 301 18 Y 1 A LYS 84 ? A LYS 84 302 18 Y 1 A LYS 85 ? A LYS 85 303 18 Y 1 A ALA 86 ? A ALA 86 304 18 Y 1 A GLN 87 ? A GLN 87 305 18 Y 1 A LYS 88 ? A LYS 88 306 18 Y 1 A PRO 89 ? A PRO 89 307 19 Y 1 A GLY 1 ? A GLY 1 308 19 Y 1 A HIS 2 ? A HIS 2 309 19 Y 1 A MET 3 ? A MET 3 310 19 Y 1 A MET 4 ? A MET 4 311 19 Y 1 A SER 5 ? A SER 5 312 19 Y 1 A SER 6 ? A SER 6 313 19 Y 1 A THR 7 ? A THR 7 314 19 Y 1 A SER 8 ? A SER 8 315 19 Y 1 A PRO 9 ? A PRO 9 316 19 Y 1 A LYS 82 ? A LYS 82 317 19 Y 1 A GLU 83 ? A GLU 83 318 19 Y 1 A LYS 84 ? A LYS 84 319 19 Y 1 A LYS 85 ? A LYS 85 320 19 Y 1 A ALA 86 ? A ALA 86 321 19 Y 1 A GLN 87 ? A GLN 87 322 19 Y 1 A LYS 88 ? A LYS 88 323 19 Y 1 A PRO 89 ? A PRO 89 324 20 Y 1 A GLY 1 ? A GLY 1 325 20 Y 1 A HIS 2 ? A HIS 2 326 20 Y 1 A MET 3 ? A MET 3 327 20 Y 1 A MET 4 ? A MET 4 328 20 Y 1 A SER 5 ? A SER 5 329 20 Y 1 A SER 6 ? A SER 6 330 20 Y 1 A THR 7 ? A THR 7 331 20 Y 1 A SER 8 ? A SER 8 332 20 Y 1 A PRO 9 ? A PRO 9 333 20 Y 1 A LYS 82 ? A LYS 82 334 20 Y 1 A GLU 83 ? A GLU 83 335 20 Y 1 A LYS 84 ? A LYS 84 336 20 Y 1 A LYS 85 ? A LYS 85 337 20 Y 1 A ALA 86 ? A ALA 86 338 20 Y 1 A GLN 87 ? A GLN 87 339 20 Y 1 A LYS 88 ? A LYS 88 340 20 Y 1 A PRO 89 ? A PRO 89 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2JQH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_