data_2JQI # _entry.id 2JQI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JQI pdb_00002jqi 10.2210/pdb2jqi/pdb RCSB RCSB100162 ? ? WWPDB D_1000100162 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-06-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2023-12-20 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' Other 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_conn 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_database_status 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JQI _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2JQJ . unspecified PDB 2JQL . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yuan, C.' 1 'Mahajan, A.' 2 'Tsai, M.' 3 # _citation.id primary _citation.title 'Diphosphothreonine-specific interaction between an SQ/TQ cluster and an FHA domain in the Rad53-Dun1 kinase cascade.' _citation.journal_abbrev Mol.Cell _citation.journal_volume 30 _citation.page_first 767 _citation.page_last 778 _citation.year 2008 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18570878 _citation.pdbx_database_id_DOI 10.1016/j.molcel.2008.05.013 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, H.' 1 ? primary 'Yuan, C.' 2 ? primary 'Hammet, A.' 3 ? primary 'Mahajan, A.' 4 ? primary 'Chen, E.S.' 5 ? primary 'Wu, M.R.' 6 ? primary 'Su, M.I.' 7 ? primary 'Heierhorst, J.' 8 ? primary 'Tsai, M.D.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase RAD53' 17093.490 1 2.7.11.1 ? ? ? 2 polymer syn 'Serine/threonine-protein kinase RAD53' 1197.146 1 2.7.11.1 ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Serine-protein kinase 1' 2 'Serine-protein kinase 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILL GEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR ; ;ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILL GEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR ; A ? 2 'polypeptide(L)' no yes 'NI(TPO)QPTQQST' NITQPTQQST B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 GLN n 1 4 ARG n 1 5 PHE n 1 6 LEU n 1 7 ILE n 1 8 GLU n 1 9 LYS n 1 10 PHE n 1 11 SER n 1 12 GLN n 1 13 GLU n 1 14 GLN n 1 15 ILE n 1 16 GLY n 1 17 GLU n 1 18 ASN n 1 19 ILE n 1 20 VAL n 1 21 CYS n 1 22 ARG n 1 23 VAL n 1 24 ILE n 1 25 CYS n 1 26 THR n 1 27 THR n 1 28 GLY n 1 29 GLN n 1 30 ILE n 1 31 PRO n 1 32 ILE n 1 33 ARG n 1 34 ASP n 1 35 LEU n 1 36 SER n 1 37 ALA n 1 38 ASP n 1 39 ILE n 1 40 SER n 1 41 GLN n 1 42 VAL n 1 43 LEU n 1 44 LYS n 1 45 GLU n 1 46 LYS n 1 47 ARG n 1 48 SER n 1 49 ILE n 1 50 LYS n 1 51 LYS n 1 52 VAL n 1 53 TRP n 1 54 THR n 1 55 PHE n 1 56 GLY n 1 57 ARG n 1 58 ASN n 1 59 PRO n 1 60 ALA n 1 61 CYS n 1 62 ASP n 1 63 TYR n 1 64 HIS n 1 65 LEU n 1 66 GLY n 1 67 ASN n 1 68 ILE n 1 69 SER n 1 70 ARG n 1 71 LEU n 1 72 SER n 1 73 ASN n 1 74 LYS n 1 75 HIS n 1 76 PHE n 1 77 GLN n 1 78 ILE n 1 79 LEU n 1 80 LEU n 1 81 GLY n 1 82 GLU n 1 83 ASP n 1 84 GLY n 1 85 ASN n 1 86 LEU n 1 87 LEU n 1 88 LEU n 1 89 ASN n 1 90 ASP n 1 91 ILE n 1 92 SER n 1 93 THR n 1 94 ASN n 1 95 GLY n 1 96 THR n 1 97 TRP n 1 98 LEU n 1 99 ASN n 1 100 GLY n 1 101 GLN n 1 102 LYS n 1 103 VAL n 1 104 GLU n 1 105 LYS n 1 106 ASN n 1 107 SER n 1 108 ASN n 1 109 GLN n 1 110 LEU n 1 111 LEU n 1 112 SER n 1 113 GLN n 1 114 GLY n 1 115 ASP n 1 116 GLU n 1 117 ILE n 1 118 THR n 1 119 VAL n 1 120 GLY n 1 121 VAL n 1 122 GLY n 1 123 VAL n 1 124 GLU n 1 125 SER n 1 126 ASP n 1 127 ILE n 1 128 LEU n 1 129 SER n 1 130 LEU n 1 131 VAL n 1 132 ILE n 1 133 PHE n 1 134 ILE n 1 135 ASN n 1 136 ASP n 1 137 LYS n 1 138 PHE n 1 139 LYS n 1 140 GLN n 1 141 CYS n 1 142 LEU n 1 143 GLU n 1 144 GLN n 1 145 ASN n 1 146 LYS n 1 147 VAL n 1 148 ASP n 1 149 ARG n 1 150 ILE n 1 151 ARG n 2 1 ASN n 2 2 ILE n 2 3 TPO n 2 4 GLN n 2 5 PRO n 2 6 THR n 2 7 GLN n 2 8 GLN n 2 9 SER n 2 10 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RAD53, MEC2, SAD1, SPK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 14 14 ALA ALA A . n A 1 2 THR 2 15 15 THR THR A . n A 1 3 GLN 3 16 16 GLN GLN A . n A 1 4 ARG 4 17 17 ARG ARG A . n A 1 5 PHE 5 18 18 PHE PHE A . n A 1 6 LEU 6 19 19 LEU LEU A . n A 1 7 ILE 7 20 20 ILE ILE A . n A 1 8 GLU 8 21 21 GLU GLU A . n A 1 9 LYS 9 22 22 LYS LYS A . n A 1 10 PHE 10 23 23 PHE PHE A . n A 1 11 SER 11 24 24 SER SER A . n A 1 12 GLN 12 25 25 GLN GLN A . n A 1 13 GLU 13 26 26 GLU GLU A . n A 1 14 GLN 14 27 27 GLN GLN A . n A 1 15 ILE 15 28 28 ILE ILE A . n A 1 16 GLY 16 29 29 GLY GLY A . n A 1 17 GLU 17 30 30 GLU GLU A . n A 1 18 ASN 18 31 31 ASN ASN A . n A 1 19 ILE 19 32 32 ILE ILE A . n A 1 20 VAL 20 33 33 VAL VAL A . n A 1 21 CYS 21 34 34 CYS CYS A . n A 1 22 ARG 22 35 35 ARG ARG A . n A 1 23 VAL 23 36 36 VAL VAL A . n A 1 24 ILE 24 37 37 ILE ILE A . n A 1 25 CYS 25 38 38 CYS CYS A . n A 1 26 THR 26 39 39 THR THR A . n A 1 27 THR 27 40 40 THR THR A . n A 1 28 GLY 28 41 41 GLY GLY A . n A 1 29 GLN 29 42 42 GLN GLN A . n A 1 30 ILE 30 43 43 ILE ILE A . n A 1 31 PRO 31 44 44 PRO PRO A . n A 1 32 ILE 32 45 45 ILE ILE A . n A 1 33 ARG 33 46 46 ARG ARG A . n A 1 34 ASP 34 47 47 ASP ASP A . n A 1 35 LEU 35 48 48 LEU LEU A . n A 1 36 SER 36 49 49 SER SER A . n A 1 37 ALA 37 50 50 ALA ALA A . n A 1 38 ASP 38 51 51 ASP ASP A . n A 1 39 ILE 39 52 52 ILE ILE A . n A 1 40 SER 40 53 53 SER SER A . n A 1 41 GLN 41 54 54 GLN GLN A . n A 1 42 VAL 42 55 55 VAL VAL A . n A 1 43 LEU 43 56 56 LEU LEU A . n A 1 44 LYS 44 57 57 LYS LYS A . n A 1 45 GLU 45 58 58 GLU GLU A . n A 1 46 LYS 46 59 59 LYS LYS A . n A 1 47 ARG 47 60 60 ARG ARG A . n A 1 48 SER 48 61 61 SER SER A . n A 1 49 ILE 49 62 62 ILE ILE A . n A 1 50 LYS 50 63 63 LYS LYS A . n A 1 51 LYS 51 64 64 LYS LYS A . n A 1 52 VAL 52 65 65 VAL VAL A . n A 1 53 TRP 53 66 66 TRP TRP A . n A 1 54 THR 54 67 67 THR THR A . n A 1 55 PHE 55 68 68 PHE PHE A . n A 1 56 GLY 56 69 69 GLY GLY A . n A 1 57 ARG 57 70 70 ARG ARG A . n A 1 58 ASN 58 71 71 ASN ASN A . n A 1 59 PRO 59 72 72 PRO PRO A . n A 1 60 ALA 60 73 73 ALA ALA A . n A 1 61 CYS 61 74 74 CYS CYS A . n A 1 62 ASP 62 75 75 ASP ASP A . n A 1 63 TYR 63 76 76 TYR TYR A . n A 1 64 HIS 64 77 77 HIS HIS A . n A 1 65 LEU 65 78 78 LEU LEU A . n A 1 66 GLY 66 79 79 GLY GLY A . n A 1 67 ASN 67 80 80 ASN ASN A . n A 1 68 ILE 68 81 81 ILE ILE A . n A 1 69 SER 69 82 82 SER SER A . n A 1 70 ARG 70 83 83 ARG ARG A . n A 1 71 LEU 71 84 84 LEU LEU A . n A 1 72 SER 72 85 85 SER SER A . n A 1 73 ASN 73 86 86 ASN ASN A . n A 1 74 LYS 74 87 87 LYS LYS A . n A 1 75 HIS 75 88 88 HIS HIS A . n A 1 76 PHE 76 89 89 PHE PHE A . n A 1 77 GLN 77 90 90 GLN GLN A . n A 1 78 ILE 78 91 91 ILE ILE A . n A 1 79 LEU 79 92 92 LEU LEU A . n A 1 80 LEU 80 93 93 LEU LEU A . n A 1 81 GLY 81 94 94 GLY GLY A . n A 1 82 GLU 82 95 95 GLU GLU A . n A 1 83 ASP 83 96 96 ASP ASP A . n A 1 84 GLY 84 97 97 GLY GLY A . n A 1 85 ASN 85 98 98 ASN ASN A . n A 1 86 LEU 86 99 99 LEU LEU A . n A 1 87 LEU 87 100 100 LEU LEU A . n A 1 88 LEU 88 101 101 LEU LEU A . n A 1 89 ASN 89 102 102 ASN ASN A . n A 1 90 ASP 90 103 103 ASP ASP A . n A 1 91 ILE 91 104 104 ILE ILE A . n A 1 92 SER 92 105 105 SER SER A . n A 1 93 THR 93 106 106 THR THR A . n A 1 94 ASN 94 107 107 ASN ASN A . n A 1 95 GLY 95 108 108 GLY GLY A . n A 1 96 THR 96 109 109 THR THR A . n A 1 97 TRP 97 110 110 TRP TRP A . n A 1 98 LEU 98 111 111 LEU LEU A . n A 1 99 ASN 99 112 112 ASN ASN A . n A 1 100 GLY 100 113 113 GLY GLY A . n A 1 101 GLN 101 114 114 GLN GLN A . n A 1 102 LYS 102 115 115 LYS LYS A . n A 1 103 VAL 103 116 116 VAL VAL A . n A 1 104 GLU 104 117 117 GLU GLU A . n A 1 105 LYS 105 118 118 LYS LYS A . n A 1 106 ASN 106 119 119 ASN ASN A . n A 1 107 SER 107 120 120 SER SER A . n A 1 108 ASN 108 121 121 ASN ASN A . n A 1 109 GLN 109 122 122 GLN GLN A . n A 1 110 LEU 110 123 123 LEU LEU A . n A 1 111 LEU 111 124 124 LEU LEU A . n A 1 112 SER 112 125 125 SER SER A . n A 1 113 GLN 113 126 126 GLN GLN A . n A 1 114 GLY 114 127 127 GLY GLY A . n A 1 115 ASP 115 128 128 ASP ASP A . n A 1 116 GLU 116 129 129 GLU GLU A . n A 1 117 ILE 117 130 130 ILE ILE A . n A 1 118 THR 118 131 131 THR THR A . n A 1 119 VAL 119 132 132 VAL VAL A . n A 1 120 GLY 120 133 133 GLY GLY A . n A 1 121 VAL 121 134 134 VAL VAL A . n A 1 122 GLY 122 135 135 GLY GLY A . n A 1 123 VAL 123 136 136 VAL VAL A . n A 1 124 GLU 124 137 137 GLU GLU A . n A 1 125 SER 125 138 138 SER SER A . n A 1 126 ASP 126 139 139 ASP ASP A . n A 1 127 ILE 127 140 140 ILE ILE A . n A 1 128 LEU 128 141 141 LEU LEU A . n A 1 129 SER 129 142 142 SER SER A . n A 1 130 LEU 130 143 143 LEU LEU A . n A 1 131 VAL 131 144 144 VAL VAL A . n A 1 132 ILE 132 145 145 ILE ILE A . n A 1 133 PHE 133 146 146 PHE PHE A . n A 1 134 ILE 134 147 147 ILE ILE A . n A 1 135 ASN 135 148 148 ASN ASN A . n A 1 136 ASP 136 149 149 ASP ASP A . n A 1 137 LYS 137 150 150 LYS LYS A . n A 1 138 PHE 138 151 151 PHE PHE A . n A 1 139 LYS 139 152 152 LYS LYS A . n A 1 140 GLN 140 153 153 GLN GLN A . n A 1 141 CYS 141 154 154 CYS CYS A . n A 1 142 LEU 142 155 155 LEU LEU A . n A 1 143 GLU 143 156 156 GLU GLU A . n A 1 144 GLN 144 157 157 GLN GLN A . n A 1 145 ASN 145 158 158 ASN ASN A . n A 1 146 LYS 146 159 159 LYS LYS A . n A 1 147 VAL 147 160 160 VAL VAL A . n A 1 148 ASP 148 161 161 ASP ASP A . n A 1 149 ARG 149 162 162 ARG ARG A . n A 1 150 ILE 150 163 163 ILE ILE A . n A 1 151 ARG 151 164 164 ARG ARG A . n B 2 1 ASN 1 3 3 ASN ASN B . n B 2 2 ILE 2 4 4 ILE ILE B . n B 2 3 TPO 3 5 5 TPO TPO B . n B 2 4 GLN 4 6 6 GLN GLN B . n B 2 5 PRO 5 7 7 PRO PRO B . n B 2 6 THR 6 8 8 THR THR B . n B 2 7 GLN 7 9 9 GLN GLN B . n B 2 8 GLN 8 10 10 GLN GLN B . n B 2 9 SER 9 11 11 SER SER B . n B 2 10 THR 10 12 12 THR THR B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JQI _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JQI _struct.title 'NMR Structure of the Rad53 FHA1 domain in complex with a phosphothreonien peptide derived from Rad53 SCD1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JQI _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text 'Protein/phosphopeptide, CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP RAD53_YEAST P22216 1 ;ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILL GEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR ; 14 ? 2 UNP RAD53_YEAST P22216 2 NITQPTQQST 3 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2JQI A 1 ? 151 ? P22216 14 ? 164 ? 14 164 2 2 2JQI B 1 ? 10 ? P22216 3 ? 12 ? 3 12 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 2JQI _struct_ref_seq_dif.mon_id TPO _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 3 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P22216 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 5 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 5 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 2 ? GLN A 12 ? THR A 15 GLN A 25 1 ? 11 HELX_P HELX_P2 2 ASP A 38 ? GLU A 45 ? ASP A 51 GLU A 58 1 ? 8 HELX_P HELX_P3 3 ASN A 135 ? ASN A 145 ? ASN A 148 ASN A 158 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ILE 2 C ? ? ? 1_555 B TPO 3 N ? ? B ILE 4 B TPO 5 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? B TPO 3 C ? ? ? 1_555 B GLN 4 N ? ? B TPO 5 B GLN 6 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id TPO _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 3 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id TPO _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 5 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id THR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id TPO _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 33 ? SER A 36 ? ARG A 46 SER A 49 A 2 ILE A 19 ? CYS A 25 ? ILE A 32 CYS A 38 A 3 LEU A 128 ? ILE A 134 ? LEU A 141 ILE A 147 A 4 GLU A 116 ? VAL A 119 ? GLU A 129 VAL A 132 A 5 THR A 96 ? LEU A 98 ? THR A 109 LEU A 111 A 6 GLN A 101 ? LYS A 102 ? GLN A 114 LYS A 115 B 1 TYR A 63 ? HIS A 64 ? TYR A 76 HIS A 77 B 2 LYS A 51 ? GLY A 56 ? LYS A 64 GLY A 69 B 3 PHE A 76 ? GLY A 81 ? PHE A 89 GLY A 94 B 4 ASN A 85 ? ASP A 90 ? ASN A 98 ASP A 103 B 5 ASN A 108 ? LEU A 110 ? ASN A 121 LEU A 123 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 35 ? O LEU A 48 N VAL A 20 ? N VAL A 33 A 2 3 N ARG A 22 ? N ARG A 35 O PHE A 133 ? O PHE A 146 A 3 4 O LEU A 128 ? O LEU A 141 N VAL A 119 ? N VAL A 132 A 4 5 O THR A 118 ? O THR A 131 N TRP A 97 ? N TRP A 110 A 5 6 N LEU A 98 ? N LEU A 111 O GLN A 101 ? O GLN A 114 B 1 2 O TYR A 63 ? O TYR A 76 N GLY A 56 ? N GLY A 69 B 2 3 N PHE A 55 ? N PHE A 68 O PHE A 76 ? O PHE A 89 B 3 4 N GLN A 77 ? N GLN A 90 O ASN A 89 ? O ASN A 102 B 4 5 N LEU A 88 ? N LEU A 101 O GLN A 109 ? O GLN A 122 # _pdbx_entry_details.entry_id 2JQI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A TRP 66 ? ? O A ILE 91 ? ? 1.53 2 1 H A PHE 68 ? ? O A PHE 89 ? ? 1.59 3 2 H A PHE 68 ? ? O A PHE 89 ? ? 1.54 4 2 H A TRP 66 ? ? O A ILE 91 ? ? 1.56 5 2 H A ARG 35 ? ? O A PHE 146 ? ? 1.57 6 2 H A GLN 90 ? ? O A ASN 102 ? ? 1.60 7 3 H A PHE 68 ? ? O A PHE 89 ? ? 1.52 8 3 H A TRP 66 ? ? O A ILE 91 ? ? 1.55 9 3 H A GLN 90 ? ? O A ASN 102 ? ? 1.59 10 4 H A TRP 66 ? ? O A ILE 91 ? ? 1.55 11 4 H A PHE 68 ? ? O A PHE 89 ? ? 1.56 12 5 H A TRP 66 ? ? O A ILE 91 ? ? 1.53 13 5 H A PHE 68 ? ? O A PHE 89 ? ? 1.54 14 5 O A ARG 35 ? ? H A PHE 146 ? ? 1.59 15 6 H A PHE 68 ? ? O A PHE 89 ? ? 1.55 16 6 H A TRP 66 ? ? O A ILE 91 ? ? 1.57 17 7 H A PHE 68 ? ? O A PHE 89 ? ? 1.56 18 7 H A TRP 66 ? ? O A ILE 91 ? ? 1.56 19 7 O A TRP 66 ? ? H A ILE 91 ? ? 1.60 20 8 H A PHE 68 ? ? O A PHE 89 ? ? 1.53 21 8 H A TRP 66 ? ? O A ILE 91 ? ? 1.54 22 8 O A ARG 35 ? ? H A PHE 146 ? ? 1.59 23 9 H A TRP 66 ? ? O A ILE 91 ? ? 1.55 24 9 H A PHE 68 ? ? O A PHE 89 ? ? 1.56 25 9 H A GLN 90 ? ? O A ASN 102 ? ? 1.59 26 10 H A TRP 66 ? ? O A ILE 91 ? ? 1.56 27 10 H A PHE 68 ? ? O A PHE 89 ? ? 1.56 28 10 H A GLN 90 ? ? O A ASN 102 ? ? 1.58 29 11 H A TRP 66 ? ? O A ILE 91 ? ? 1.55 30 11 H A PHE 68 ? ? O A PHE 89 ? ? 1.56 31 11 H A GLN 90 ? ? O A ASN 102 ? ? 1.58 32 11 O A ARG 35 ? ? H A PHE 146 ? ? 1.58 33 11 O A VAL 132 ? ? H A LEU 141 ? ? 1.59 34 12 H A TRP 66 ? ? O A ILE 91 ? ? 1.55 35 12 H A PHE 68 ? ? O A PHE 89 ? ? 1.56 36 12 O A ARG 35 ? ? H A PHE 146 ? ? 1.57 37 12 H A GLN 90 ? ? O A ASN 102 ? ? 1.58 38 13 H A PHE 68 ? ? O A PHE 89 ? ? 1.53 39 13 H A TRP 66 ? ? O A ILE 91 ? ? 1.57 40 13 O A TRP 66 ? ? H A ILE 91 ? ? 1.59 41 13 O A ARG 35 ? ? H A PHE 146 ? ? 1.60 42 14 H A PHE 68 ? ? O A PHE 89 ? ? 1.52 43 14 O A ARG 35 ? ? H A PHE 146 ? ? 1.55 44 14 H A TRP 66 ? ? O A ILE 91 ? ? 1.57 45 15 H A TRP 66 ? ? O A ILE 91 ? ? 1.56 46 15 H A PHE 68 ? ? O A PHE 89 ? ? 1.57 47 16 H A PHE 68 ? ? O A PHE 89 ? ? 1.53 48 16 H A TRP 66 ? ? O A ILE 91 ? ? 1.54 49 16 O A ARG 35 ? ? H A PHE 146 ? ? 1.59 50 17 H A PHE 68 ? ? O A PHE 89 ? ? 1.53 51 17 O A ARG 35 ? ? H A PHE 146 ? ? 1.58 52 17 H A TRP 66 ? ? O A ILE 91 ? ? 1.59 53 17 O A VAL 132 ? ? H A LEU 141 ? ? 1.60 54 18 H A PHE 68 ? ? O A PHE 89 ? ? 1.55 55 18 H A TRP 66 ? ? O A ILE 91 ? ? 1.56 56 18 H A GLN 90 ? ? O A ASN 102 ? ? 1.60 57 19 H A PHE 68 ? ? O A PHE 89 ? ? 1.55 58 19 H A TRP 66 ? ? O A ILE 91 ? ? 1.56 59 20 H A PHE 68 ? ? O A PHE 89 ? ? 1.54 60 20 H A TRP 66 ? ? O A ILE 91 ? ? 1.54 61 20 H A ARG 35 ? ? O A PHE 146 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 15 ? ? -128.73 -61.08 2 1 ASN A 31 ? ? 178.60 38.53 3 1 VAL A 33 ? ? -92.32 -60.00 4 1 GLN A 42 ? ? -146.32 -42.92 5 1 SER A 61 ? ? 61.19 -85.00 6 1 LYS A 63 ? ? -106.45 -68.53 7 1 ASN A 80 ? ? 178.78 54.34 8 1 GLU A 95 ? ? 56.05 -165.32 9 1 ASN A 119 ? ? 34.63 35.02 10 1 ASP A 128 ? ? -52.14 170.53 11 1 ASN A 158 ? ? 42.45 92.28 12 1 ILE B 4 ? ? 52.47 161.55 13 2 THR A 15 ? ? -158.27 -55.42 14 2 ASN A 31 ? ? 179.62 37.81 15 2 VAL A 33 ? ? -92.26 -60.76 16 2 GLN A 42 ? ? -161.72 -47.35 17 2 GLU A 58 ? ? -62.82 99.76 18 2 ARG A 60 ? ? 64.82 95.87 19 2 SER A 61 ? ? -179.32 -168.41 20 2 LYS A 63 ? ? 61.20 -76.64 21 2 GLU A 95 ? ? 69.11 -67.19 22 2 ASP A 96 ? ? -140.87 -47.19 23 2 ASN A 98 ? ? -59.74 179.80 24 2 ILE A 104 ? ? -143.84 39.08 25 2 ASN A 119 ? ? 35.43 35.04 26 2 ASP A 128 ? ? -55.23 174.37 27 2 ASN A 158 ? ? 44.85 -172.42 28 2 ASP A 161 ? ? -134.12 -48.20 29 2 ILE B 4 ? ? 52.04 157.46 30 2 THR B 8 ? ? -163.49 111.68 31 2 GLN B 9 ? ? 58.88 97.25 32 3 GLN A 25 ? ? 59.67 81.26 33 3 ASN A 31 ? ? 177.11 38.56 34 3 VAL A 33 ? ? -92.75 -61.58 35 3 GLN A 42 ? ? -147.95 -41.00 36 3 ASN A 80 ? ? -69.93 89.43 37 3 GLU A 95 ? ? 62.38 -80.39 38 3 ASP A 96 ? ? -169.39 42.93 39 3 ILE A 104 ? ? -149.22 38.18 40 3 ASN A 119 ? ? 35.02 34.72 41 3 ASN A 158 ? ? -115.61 65.32 42 3 PRO B 7 ? ? -71.04 -168.70 43 3 SER B 11 ? ? 60.85 79.98 44 4 ASN A 31 ? ? 178.80 37.97 45 4 VAL A 33 ? ? -93.10 -60.87 46 4 GLN A 42 ? ? -146.29 -44.29 47 4 ARG A 60 ? ? -54.09 176.43 48 4 LYS A 63 ? ? -127.92 -68.45 49 4 ASN A 80 ? ? -67.32 84.27 50 4 GLU A 95 ? ? 63.18 90.47 51 4 ASP A 96 ? ? 63.60 -78.61 52 4 ILE A 104 ? ? -143.91 34.60 53 4 ASN A 119 ? ? 34.77 35.44 54 4 ASN A 158 ? ? 42.59 89.81 55 4 ARG A 162 ? ? -178.43 -37.90 56 4 PRO B 7 ? ? -72.78 -167.66 57 4 SER B 11 ? ? 63.66 95.43 58 5 THR A 15 ? ? 74.55 -59.22 59 5 ASN A 31 ? ? -169.60 33.13 60 5 VAL A 33 ? ? -93.66 -62.10 61 5 GLN A 42 ? ? -146.89 -43.48 62 5 GLU A 58 ? ? -69.70 98.99 63 5 LYS A 59 ? ? -98.21 39.68 64 5 LYS A 63 ? ? -93.48 -65.07 65 5 LEU A 78 ? ? -102.34 -64.04 66 5 ASN A 80 ? ? -179.27 49.61 67 5 GLU A 95 ? ? 59.16 105.95 68 5 ASP A 96 ? ? 59.09 -177.07 69 5 ILE A 104 ? ? -141.72 39.44 70 5 ASN A 119 ? ? 36.20 32.47 71 5 ASP A 128 ? ? -54.79 170.49 72 5 ASP A 161 ? ? -158.42 -61.19 73 5 PRO B 7 ? ? -57.55 -170.00 74 5 SER B 11 ? ? 61.60 114.13 75 6 THR A 15 ? ? -142.42 -54.18 76 6 GLN A 25 ? ? 64.10 -78.80 77 6 ASN A 31 ? ? 177.27 39.31 78 6 VAL A 33 ? ? -91.16 -61.08 79 6 GLN A 42 ? ? -164.30 -49.55 80 6 SER A 61 ? ? 63.66 137.22 81 6 ILE A 62 ? ? 56.49 166.03 82 6 LYS A 63 ? ? -137.60 -59.22 83 6 LEU A 78 ? ? -99.00 -69.92 84 6 ASN A 80 ? ? 177.95 55.64 85 6 GLU A 95 ? ? -59.42 172.79 86 6 ASP A 96 ? ? 57.69 -171.26 87 6 ASN A 119 ? ? 32.82 34.74 88 6 ASP A 128 ? ? -50.99 172.02 89 6 ASN A 158 ? ? 44.75 -171.60 90 7 ASN A 31 ? ? 176.23 39.34 91 7 GLN A 42 ? ? -147.35 -43.25 92 7 ARG A 60 ? ? -65.37 -167.10 93 7 LYS A 63 ? ? -131.31 -49.16 94 7 LEU A 78 ? ? -92.85 -77.77 95 7 ASN A 80 ? ? 173.65 48.54 96 7 GLU A 95 ? ? -124.00 -57.90 97 7 ASP A 96 ? ? -150.34 37.49 98 7 ILE A 104 ? ? -145.15 39.61 99 7 ASN A 119 ? ? 34.51 34.90 100 7 ASP A 128 ? ? -56.21 172.09 101 7 ASP A 161 ? ? 60.97 112.38 102 7 TPO B 5 ? ? 65.41 117.44 103 7 GLN B 10 ? ? -169.95 87.54 104 7 SER B 11 ? ? 60.19 86.59 105 8 ASN A 31 ? ? 178.61 38.31 106 8 VAL A 33 ? ? -92.65 -62.57 107 8 GLN A 42 ? ? -146.97 -39.75 108 8 LYS A 59 ? ? -98.45 30.70 109 8 ARG A 60 ? ? -115.67 -167.18 110 8 SER A 61 ? ? -95.13 44.07 111 8 LYS A 63 ? ? -124.40 -58.71 112 8 LEU A 78 ? ? -100.10 -69.61 113 8 ASN A 80 ? ? -178.74 54.99 114 8 GLU A 95 ? ? 58.39 -171.94 115 8 ASN A 98 ? ? 63.00 162.62 116 8 ILE A 104 ? ? -141.35 40.07 117 8 ASN A 119 ? ? 34.52 36.22 118 8 GLN B 9 ? ? -59.21 175.99 119 9 ASN A 31 ? ? 177.68 38.42 120 9 VAL A 33 ? ? -92.67 -60.16 121 9 GLN A 42 ? ? -148.56 -40.70 122 9 ARG A 60 ? ? -48.32 99.60 123 9 SER A 61 ? ? -175.04 -45.89 124 9 LYS A 63 ? ? -132.72 -63.71 125 9 LEU A 78 ? ? -76.70 -166.52 126 9 ASN A 80 ? ? 61.25 79.69 127 9 GLU A 95 ? ? 84.77 -21.79 128 9 ASP A 96 ? ? -177.46 -46.33 129 9 ILE A 104 ? ? -147.88 40.06 130 9 ASN A 119 ? ? 34.53 34.89 131 9 ASP A 128 ? ? -54.78 170.43 132 9 ASN A 158 ? ? 42.69 -91.00 133 9 PRO B 7 ? ? -69.05 -167.50 134 10 THR A 15 ? ? -139.55 -47.65 135 10 GLN A 25 ? ? 64.34 72.80 136 10 ASN A 31 ? ? 178.56 38.32 137 10 VAL A 33 ? ? -91.43 -61.70 138 10 GLN A 42 ? ? -159.72 -40.67 139 10 LYS A 63 ? ? -126.60 -66.75 140 10 GLU A 95 ? ? 61.61 -168.74 141 10 ILE A 104 ? ? -150.39 36.94 142 10 ASN A 119 ? ? 33.84 35.33 143 10 ASP A 128 ? ? -50.46 170.18 144 10 ASN A 158 ? ? 44.41 -171.55 145 10 GLN B 6 ? ? -57.43 108.80 146 11 ASN A 31 ? ? 177.18 38.89 147 11 VAL A 33 ? ? -91.95 -60.58 148 11 GLN A 42 ? ? -146.03 -44.84 149 11 CYS A 74 ? ? -38.88 139.70 150 11 ASN A 80 ? ? -62.93 79.47 151 11 GLU A 95 ? ? 68.74 -67.76 152 11 ASP A 96 ? ? -178.03 -66.75 153 11 ILE A 104 ? ? -143.46 30.78 154 11 ASN A 119 ? ? 34.89 34.75 155 11 ASP A 128 ? ? -49.88 165.19 156 11 ASN A 158 ? ? 42.53 86.05 157 11 PRO B 7 ? ? -55.15 -170.70 158 11 GLN B 10 ? ? -98.09 50.00 159 12 THR A 15 ? ? -112.33 67.16 160 12 GLN A 25 ? ? 64.63 -76.08 161 12 ASN A 31 ? ? 179.04 38.04 162 12 GLN A 42 ? ? -146.05 -44.49 163 12 ARG A 60 ? ? 59.29 100.75 164 12 SER A 61 ? ? -178.71 -63.07 165 12 ILE A 62 ? ? -178.77 130.30 166 12 LYS A 63 ? ? -102.74 -62.17 167 12 LEU A 78 ? ? -110.32 78.91 168 12 ASN A 80 ? ? -176.71 92.32 169 12 GLU A 95 ? ? 58.22 -165.99 170 12 ASN A 98 ? ? 62.27 171.38 171 12 ILE A 104 ? ? -149.60 36.64 172 12 ASN A 119 ? ? 35.33 33.78 173 12 ASP A 128 ? ? -55.87 175.25 174 12 ASP A 161 ? ? -163.86 -43.55 175 12 TPO B 5 ? ? 57.53 92.50 176 12 PRO B 7 ? ? -74.67 -168.36 177 13 THR A 15 ? ? -124.47 -64.84 178 13 ASN A 31 ? ? 177.14 38.83 179 13 GLN A 42 ? ? -145.73 -44.49 180 13 LEU A 78 ? ? -79.78 -80.12 181 13 ASN A 80 ? ? -178.57 47.36 182 13 GLU A 95 ? ? 63.92 -79.62 183 13 ASP A 96 ? ? -164.11 37.06 184 13 ILE A 104 ? ? -148.12 39.92 185 13 ASN A 119 ? ? 33.97 35.60 186 13 ASP A 128 ? ? -51.69 170.22 187 13 ASN A 158 ? ? 44.96 -172.93 188 13 TPO B 5 ? ? 63.24 149.06 189 13 GLN B 9 ? ? -59.75 176.83 190 14 ASN A 31 ? ? 174.60 39.86 191 14 VAL A 33 ? ? -92.72 -60.13 192 14 GLN A 42 ? ? -147.33 -43.39 193 14 ILE A 62 ? ? 52.41 158.72 194 14 LYS A 63 ? ? -140.20 -64.92 195 14 ASN A 80 ? ? -154.17 65.16 196 14 GLU A 95 ? ? 68.97 -67.11 197 14 ASP A 96 ? ? -171.46 45.01 198 14 ILE A 104 ? ? -145.56 30.99 199 14 ASN A 119 ? ? 38.34 32.77 200 14 ASP A 128 ? ? -54.83 172.80 201 14 TPO B 5 ? ? 64.01 85.92 202 14 GLN B 6 ? ? -57.01 109.65 203 14 GLN B 9 ? ? -68.39 83.71 204 15 GLN A 25 ? ? -66.52 79.85 205 15 ASN A 31 ? ? -175.08 33.38 206 15 GLN A 42 ? ? -144.06 -43.65 207 15 LYS A 59 ? ? -103.74 62.86 208 15 ASN A 80 ? ? 63.88 78.55 209 15 GLU A 95 ? ? 60.13 103.10 210 15 ASP A 96 ? ? 67.76 -70.71 211 15 ILE A 104 ? ? -142.72 40.04 212 15 ASN A 119 ? ? 34.63 34.11 213 15 ASP A 128 ? ? -58.41 172.88 214 15 ASN A 158 ? ? 42.43 87.34 215 15 ASP A 161 ? ? 62.60 115.82 216 15 PRO B 7 ? ? -74.05 -169.79 217 16 ASN A 31 ? ? 177.54 38.49 218 16 VAL A 33 ? ? -91.26 -61.37 219 16 GLN A 42 ? ? -146.70 -42.15 220 16 SER A 61 ? ? 61.34 -168.83 221 16 LYS A 63 ? ? -65.89 -71.81 222 16 LEU A 78 ? ? -124.59 -68.46 223 16 ASN A 80 ? ? -159.76 65.70 224 16 GLU A 95 ? ? 62.70 105.63 225 16 ASP A 96 ? ? 63.51 -80.03 226 16 ILE A 104 ? ? -146.44 40.86 227 16 ASN A 119 ? ? 35.05 34.37 228 16 ASP A 128 ? ? -53.03 174.01 229 16 ILE B 4 ? ? 42.67 93.15 230 16 SER B 11 ? ? 60.63 85.34 231 17 THR A 15 ? ? -140.98 -59.71 232 17 GLN A 25 ? ? 62.43 169.26 233 17 ASN A 31 ? ? 177.92 40.86 234 17 GLN A 42 ? ? -145.77 -42.99 235 17 ILE A 62 ? ? 54.09 172.29 236 17 LYS A 63 ? ? -132.09 -63.58 237 17 LEU A 78 ? ? -85.52 -79.98 238 17 ASN A 80 ? ? -166.54 46.10 239 17 GLU A 95 ? ? -177.30 -39.56 240 17 ASP A 96 ? ? -167.83 -42.57 241 17 ILE A 104 ? ? -148.47 38.16 242 17 ASN A 119 ? ? 35.60 32.83 243 17 ASP A 128 ? ? -53.01 172.05 244 17 ASN A 158 ? ? 43.16 -91.35 245 18 THR A 15 ? ? -105.29 -71.81 246 18 GLN A 25 ? ? 60.79 159.60 247 18 ASN A 31 ? ? 179.39 38.03 248 18 VAL A 33 ? ? -91.92 -60.41 249 18 GLN A 42 ? ? -147.46 -39.86 250 18 LYS A 59 ? ? -106.96 64.67 251 18 LYS A 63 ? ? -107.50 -75.92 252 18 GLU A 95 ? ? -53.35 172.39 253 18 ASP A 96 ? ? 59.49 167.48 254 18 ILE A 104 ? ? -145.93 40.08 255 18 ASN A 119 ? ? 35.32 33.45 256 18 ASP A 128 ? ? -57.41 173.86 257 18 ASN A 158 ? ? 44.44 -171.50 258 18 THR B 8 ? ? 61.66 149.50 259 18 GLN B 9 ? ? -56.47 175.00 260 19 ASN A 31 ? ? -177.19 36.47 261 19 VAL A 33 ? ? -91.79 -61.09 262 19 GLN A 42 ? ? -146.02 -43.76 263 19 ARG A 60 ? ? -106.12 -70.66 264 19 LYS A 63 ? ? -81.81 -78.56 265 19 LEU A 78 ? ? -71.87 -76.88 266 19 ASN A 80 ? ? -162.89 53.54 267 19 ASP A 96 ? ? 50.73 89.42 268 19 ILE A 104 ? ? -142.00 39.68 269 19 ASN A 119 ? ? 34.15 35.47 270 19 ASP A 128 ? ? -60.55 -179.01 271 19 ASN A 158 ? ? 44.94 -172.64 272 19 ARG A 162 ? ? -99.94 30.61 273 20 THR A 15 ? ? -155.70 -50.15 274 20 GLN A 25 ? ? 60.10 84.75 275 20 ASN A 31 ? ? 178.61 37.86 276 20 VAL A 33 ? ? -90.74 -60.81 277 20 GLN A 42 ? ? -147.26 -41.50 278 20 LYS A 59 ? ? -102.34 70.21 279 20 LYS A 63 ? ? -103.91 -66.66 280 20 LEU A 78 ? ? -119.29 72.87 281 20 ASN A 80 ? ? -158.69 84.04 282 20 ASP A 96 ? ? -58.07 -177.91 283 20 ILE A 104 ? ? -145.74 40.30 284 20 ASN A 119 ? ? 34.37 34.77 285 20 ASP A 128 ? ? -57.72 175.60 286 20 TPO B 5 ? ? 63.77 144.76 287 20 PRO B 7 ? ? -72.11 -169.08 288 20 SER B 11 ? ? 60.43 179.69 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 3 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 5 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details PHOSPHOTHREONINE # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry,structures with the least restraint violations,structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JQI _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JQI _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-13C; U-15N] protein, 0.8 mM peptide, 10 mM sodium phosphate, 1 mM DTT, 1 mM EDTA, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5 mM [U-13C; U-15N] protein, 0.8 mM peptide, 10 mM sodium phosphate, 1 mM DTT, 1 mM EDTA, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1 0.5 mM '[U-13C; U-15N]' 1 entity_2 0.8 mM ? 1 'sodium phosphate' 10 mM ? 1 DTT 1 mM ? 1 EDTA 1 mM ? 1 entity_1 0.5 mM '[U-13C; U-15N]' 2 entity_2 0.8 mM ? 2 'sodium phosphate' 10 mM ? 2 DTT 1 mM ? 2 EDTA 1 mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '3D 1H-13C NOESY' 1 2 1 '3D 13C/15N-filtered (f1), 13C-edited (f3) NOESY' 1 3 2 '3D 13C/15N-filtered (f1), 13C-edited (f3) NOESY' 1 4 2 '3D 13C-edited (f1), 13C/15N-filtered (f3) NOESY' 1 5 1 '2D 13C/15N-filtered (f1,f2) NOESY' 1 6 2 '2D 13C/15N-filtered (f1,f2) NOESY' 1 7 1 '2D 13C/15N-filtered (f1,f2) TOCSY' 1 8 2 '2D 13C/15N-filtered (f1,f2) TOCSY' 1 9 2 '2D 13C/15N-filtered (f1,f2) COSY' # _pdbx_nmr_refine.entry_id 2JQI _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, A.T. et al.' 'structure solution' CNS 1.1 1 'Delaglio, F. et al.' processing NMRPipe ? 2 'Johnson, B.A. et al.' 'data analysis' NMRView ? 3 'Brunger, A.T. et al.' refinement CNS 1.1 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TPO N N N N 298 TPO CA C N S 299 TPO CB C N R 300 TPO CG2 C N N 301 TPO OG1 O N N 302 TPO P P N N 303 TPO O1P O N N 304 TPO O2P O N N 305 TPO O3P O N N 306 TPO C C N N 307 TPO O O N N 308 TPO OXT O N N 309 TPO H H N N 310 TPO H2 H N N 311 TPO HA H N N 312 TPO HB H N N 313 TPO HG21 H N N 314 TPO HG22 H N N 315 TPO HG23 H N N 316 TPO HOP2 H N N 317 TPO HOP3 H N N 318 TPO HXT H N N 319 TRP N N N N 320 TRP CA C N S 321 TRP C C N N 322 TRP O O N N 323 TRP CB C N N 324 TRP CG C Y N 325 TRP CD1 C Y N 326 TRP CD2 C Y N 327 TRP NE1 N Y N 328 TRP CE2 C Y N 329 TRP CE3 C Y N 330 TRP CZ2 C Y N 331 TRP CZ3 C Y N 332 TRP CH2 C Y N 333 TRP OXT O N N 334 TRP H H N N 335 TRP H2 H N N 336 TRP HA H N N 337 TRP HB2 H N N 338 TRP HB3 H N N 339 TRP HD1 H N N 340 TRP HE1 H N N 341 TRP HE3 H N N 342 TRP HZ2 H N N 343 TRP HZ3 H N N 344 TRP HH2 H N N 345 TRP HXT H N N 346 TYR N N N N 347 TYR CA C N S 348 TYR C C N N 349 TYR O O N N 350 TYR CB C N N 351 TYR CG C Y N 352 TYR CD1 C Y N 353 TYR CD2 C Y N 354 TYR CE1 C Y N 355 TYR CE2 C Y N 356 TYR CZ C Y N 357 TYR OH O N N 358 TYR OXT O N N 359 TYR H H N N 360 TYR H2 H N N 361 TYR HA H N N 362 TYR HB2 H N N 363 TYR HB3 H N N 364 TYR HD1 H N N 365 TYR HD2 H N N 366 TYR HE1 H N N 367 TYR HE2 H N N 368 TYR HH H N N 369 TYR HXT H N N 370 VAL N N N N 371 VAL CA C N S 372 VAL C C N N 373 VAL O O N N 374 VAL CB C N N 375 VAL CG1 C N N 376 VAL CG2 C N N 377 VAL OXT O N N 378 VAL H H N N 379 VAL H2 H N N 380 VAL HA H N N 381 VAL HB H N N 382 VAL HG11 H N N 383 VAL HG12 H N N 384 VAL HG13 H N N 385 VAL HG21 H N N 386 VAL HG22 H N N 387 VAL HG23 H N N 388 VAL HXT H N N 389 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TPO N CA sing N N 285 TPO N H sing N N 286 TPO N H2 sing N N 287 TPO CA CB sing N N 288 TPO CA C sing N N 289 TPO CA HA sing N N 290 TPO CB CG2 sing N N 291 TPO CB OG1 sing N N 292 TPO CB HB sing N N 293 TPO CG2 HG21 sing N N 294 TPO CG2 HG22 sing N N 295 TPO CG2 HG23 sing N N 296 TPO OG1 P sing N N 297 TPO P O1P doub N N 298 TPO P O2P sing N N 299 TPO P O3P sing N N 300 TPO O2P HOP2 sing N N 301 TPO O3P HOP3 sing N N 302 TPO C O doub N N 303 TPO C OXT sing N N 304 TPO OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker DRX 1 'Bruker DRX' 600 Bruker DMX 2 'Bruker DMX' # _atom_sites.entry_id 2JQI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_