data_2JQN # _entry.id 2JQN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JQN pdb_00002jqn 10.2210/pdb2jqn/pdb RCSB RCSB100167 ? ? WWPDB D_1000100167 ? ? BMRB 15281 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-03 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-19 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' pdbx_struct_assembly 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_ref_seq_dif 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_database_status 10 6 'Structure model' chem_comp_atom 11 6 'Structure model' chem_comp_bond 12 6 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' 7 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 6 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JQN _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-05 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.content_type 2o0q PDB 'Xray crystal structure' unspecified CcR55 TargetDB . unspecified 15281 BMRB . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Aramini, J.M.' 1 'Rossi, P.' 2 'Moseley, H.N.B.' 3 'Wang, D.' 4 'Nwosu, C.' 5 'Cunningham, K.' 6 'Ma, L.' 7 'Xiao, R.' 8 'Liu, J.' 9 'Baran, M.C.' 10 'Swapna, G.V.T.' 11 'Acton, T.B.' 12 'Rost, B.' 13 'Montelione, G.T.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Solution NMR structure of CC0527 from Caulobacter crescentus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aramini, J.M.' 1 ? primary 'Rossi, P.' 2 ? primary 'Moseley, H.N.B.' 3 ? primary 'Wang, D.' 4 ? primary 'Nwosu, C.' 5 ? primary 'Cunningham, K.' 6 ? primary 'Ma, L.' 7 ? primary 'Xiao, R.' 8 ? primary 'Liu, J.' 9 ? primary 'Baran, M.C.' 10 ? primary 'Swapna, G.V.T.' 11 ? primary 'Acton, T.B.' 12 ? primary 'Rost, B.' 13 ? primary 'Montelione, G.T.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein' _entity.formula_weight 13529.084 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTLIYKILSRAEWDAAKAQGRFEGSAVDLADGFIHLSAGEQAQETAAKWFRGQANLVLLAVEAEPLGEDLKWEASRGGAR FPHLYRPLLVSEVTREADLDLDADGVPQLGDHLALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTLIYKILSRAEWDAAKAQGRFEGSAVDLADGFIHLSAGEQAQETAAKWFRGQANLVLLAVEAEPLGEDLKWEASRGGAR FPHLYRPLLVSEVTREADLDLDADGVPQLGDHLALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CcR55 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 LEU n 1 4 ILE n 1 5 TYR n 1 6 LYS n 1 7 ILE n 1 8 LEU n 1 9 SER n 1 10 ARG n 1 11 ALA n 1 12 GLU n 1 13 TRP n 1 14 ASP n 1 15 ALA n 1 16 ALA n 1 17 LYS n 1 18 ALA n 1 19 GLN n 1 20 GLY n 1 21 ARG n 1 22 PHE n 1 23 GLU n 1 24 GLY n 1 25 SER n 1 26 ALA n 1 27 VAL n 1 28 ASP n 1 29 LEU n 1 30 ALA n 1 31 ASP n 1 32 GLY n 1 33 PHE n 1 34 ILE n 1 35 HIS n 1 36 LEU n 1 37 SER n 1 38 ALA n 1 39 GLY n 1 40 GLU n 1 41 GLN n 1 42 ALA n 1 43 GLN n 1 44 GLU n 1 45 THR n 1 46 ALA n 1 47 ALA n 1 48 LYS n 1 49 TRP n 1 50 PHE n 1 51 ARG n 1 52 GLY n 1 53 GLN n 1 54 ALA n 1 55 ASN n 1 56 LEU n 1 57 VAL n 1 58 LEU n 1 59 LEU n 1 60 ALA n 1 61 VAL n 1 62 GLU n 1 63 ALA n 1 64 GLU n 1 65 PRO n 1 66 LEU n 1 67 GLY n 1 68 GLU n 1 69 ASP n 1 70 LEU n 1 71 LYS n 1 72 TRP n 1 73 GLU n 1 74 ALA n 1 75 SER n 1 76 ARG n 1 77 GLY n 1 78 GLY n 1 79 ALA n 1 80 ARG n 1 81 PHE n 1 82 PRO n 1 83 HIS n 1 84 LEU n 1 85 TYR n 1 86 ARG n 1 87 PRO n 1 88 LEU n 1 89 LEU n 1 90 VAL n 1 91 SER n 1 92 GLU n 1 93 VAL n 1 94 THR n 1 95 ARG n 1 96 GLU n 1 97 ALA n 1 98 ASP n 1 99 LEU n 1 100 ASP n 1 101 LEU n 1 102 ASP n 1 103 ALA n 1 104 ASP n 1 105 GLY n 1 106 VAL n 1 107 PRO n 1 108 GLN n 1 109 LEU n 1 110 GLY n 1 111 ASP n 1 112 HIS n 1 113 LEU n 1 114 ALA n 1 115 LEU n 1 116 GLU n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n 1 121 HIS n 1 122 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Caulobacter _entity_src_gen.pdbx_gene_src_gene CC0527 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caulobacter vibrioides' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 155892 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)MGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector CcR55-21.3 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 HIS 117 117 ? ? ? A . n A 1 118 HIS 118 118 ? ? ? A . n A 1 119 HIS 119 119 ? ? ? A . n A 1 120 HIS 120 120 ? ? ? A . n A 1 121 HIS 121 121 ? ? ? A . n A 1 122 HIS 122 122 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JQN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JQN _struct.title 'Solution NMR structure of CC0527 from Caulobacter crescentus. Northeast Structural Genomics Target CCR55' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JQN _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS' _struct_keywords.text 'solution NMR structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9AAR9_CAUCR _struct_ref.pdbx_db_accession Q9AAR9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTLIYKILSRAEWDAAKAQGRFEGSAVDLADGFIHLSAGEQAQETAAKWFRGQANLVLLAVEAEPLGEDLKWEASRGGAR FPHLYRPLLVSEVTREADLDLDADGVPQLGDHLA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JQN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9AAR9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 114 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 114 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JQN LEU A 115 ? UNP Q9AAR9 ? ? 'cloning artifact' 115 1 1 2JQN GLU A 116 ? UNP Q9AAR9 ? ? 'cloning artifact' 116 2 1 2JQN HIS A 117 ? UNP Q9AAR9 ? ? 'expression tag' 117 3 1 2JQN HIS A 118 ? UNP Q9AAR9 ? ? 'expression tag' 118 4 1 2JQN HIS A 119 ? UNP Q9AAR9 ? ? 'expression tag' 119 5 1 2JQN HIS A 120 ? UNP Q9AAR9 ? ? 'expression tag' 120 6 1 2JQN HIS A 121 ? UNP Q9AAR9 ? ? 'expression tag' 121 7 1 2JQN HIS A 122 ? UNP Q9AAR9 ? ? 'expression tag' 122 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 10 ? GLY A 20 ? ARG A 10 GLY A 20 1 ? 11 HELX_P HELX_P2 2 SER A 25 ? GLY A 32 ? SER A 25 GLY A 32 1 ? 8 HELX_P HELX_P3 3 ALA A 38 ? TRP A 49 ? ALA A 38 TRP A 49 1 ? 12 HELX_P HELX_P4 4 ARG A 76 ? GLY A 78 ? ARG A 76 GLY A 78 5 ? 3 HELX_P HELX_P5 5 SER A 91 ? VAL A 93 ? SER A 91 VAL A 93 5 ? 3 HELX_P HELX_P6 6 GLN A 108 ? LEU A 113 ? GLN A 108 LEU A 113 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 3 ? SER A 9 ? LEU A 3 SER A 9 A 2 LEU A 56 ? GLU A 62 ? LEU A 56 GLU A 62 A 3 ARG A 95 ? LEU A 99 ? ARG A 95 LEU A 99 B 1 ARG A 21 ? PHE A 22 ? ARG A 21 PHE A 22 B 2 LEU A 88 ? LEU A 89 ? LEU A 88 LEU A 89 C 1 ILE A 34 ? HIS A 35 ? ILE A 34 HIS A 35 C 2 ARG A 80 ? LEU A 84 ? ARG A 80 LEU A 84 C 3 LEU A 70 ? ALA A 74 ? LEU A 70 ALA A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 4 ? N ILE A 4 O VAL A 61 ? O VAL A 61 A 2 3 N ALA A 60 ? N ALA A 60 O ARG A 95 ? O ARG A 95 B 1 2 N PHE A 22 ? N PHE A 22 O LEU A 88 ? O LEU A 88 C 1 2 N ILE A 34 ? N ILE A 34 O LEU A 84 ? O LEU A 84 C 2 3 O HIS A 83 ? O HIS A 83 N LYS A 71 ? N LYS A 71 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? 72.48 -48.53 2 1 LEU A 3 ? ? -69.61 96.10 3 1 PHE A 33 ? ? 68.64 -176.69 4 1 ALA A 54 ? ? -99.18 54.12 5 1 ASN A 55 ? ? -158.80 36.37 6 1 ALA A 63 ? ? 34.16 -78.41 7 1 GLU A 64 ? ? 73.18 132.72 8 1 PRO A 65 ? ? -70.38 26.16 9 1 LEU A 66 ? ? -90.85 59.41 10 1 TRP A 72 ? ? -69.97 80.09 11 1 ASP A 102 ? ? -106.29 -162.99 12 1 PRO A 107 ? ? -51.66 101.32 13 2 GLU A 23 ? ? -73.78 -165.27 14 2 SER A 25 ? ? 163.96 163.31 15 2 ASN A 55 ? ? 55.25 81.31 16 2 GLU A 64 ? ? 68.97 133.82 17 2 GLU A 68 ? ? -149.81 25.84 18 2 TYR A 85 ? ? -96.24 37.52 19 2 LEU A 101 ? ? 62.65 -170.46 20 2 LEU A 113 ? ? -91.45 -64.42 21 2 LEU A 115 ? ? -48.88 94.81 22 3 LYS A 48 ? ? -90.17 -61.18 23 3 ASN A 55 ? ? 60.40 81.31 24 3 ALA A 63 ? ? -82.01 37.61 25 3 PRO A 65 ? ? -46.28 83.29 26 3 ARG A 76 ? ? 66.32 -75.51 27 3 PRO A 107 ? ? -57.72 104.94 28 4 ALA A 54 ? ? -95.34 39.79 29 4 ALA A 103 ? ? 56.56 -83.50 30 5 GLU A 23 ? ? -154.85 74.34 31 5 LYS A 48 ? ? -82.42 -70.62 32 5 ARG A 51 ? ? -58.39 101.91 33 5 GLU A 64 ? ? 65.70 158.89 34 5 PRO A 65 ? ? -55.90 76.55 35 5 ARG A 76 ? ? -51.39 90.95 36 5 ALA A 79 ? ? 61.36 97.04 37 5 PRO A 82 ? ? -66.31 96.99 38 5 ALA A 103 ? ? 63.42 -84.95 39 5 PRO A 107 ? ? -83.56 -73.95 40 5 GLN A 108 ? ? 56.07 -147.05 41 5 LEU A 109 ? ? -64.78 5.65 42 6 PHE A 33 ? ? 64.39 -171.91 43 6 ASP A 69 ? ? -78.86 30.49 44 6 ARG A 76 ? ? 67.32 161.23 45 6 ALA A 79 ? ? 68.06 -169.75 46 6 TYR A 85 ? ? -80.14 30.04 47 6 ALA A 103 ? ? 54.75 -86.41 48 6 VAL A 106 ? ? -156.08 -57.85 49 6 PRO A 107 ? ? -40.69 -74.54 50 6 GLN A 108 ? ? -48.69 71.50 51 6 LEU A 113 ? ? -72.32 -70.16 52 6 ALA A 114 ? ? 173.87 -82.13 53 7 SER A 37 ? ? 73.22 165.14 54 7 TRP A 49 ? ? -109.42 -66.05 55 7 ARG A 51 ? ? -63.31 2.16 56 7 PRO A 82 ? ? -65.98 99.50 57 7 LEU A 88 ? ? -67.12 87.78 58 7 ALA A 103 ? ? 61.14 -82.17 59 7 ALA A 114 ? ? 76.82 -49.84 60 7 LEU A 115 ? ? 73.37 -61.89 61 8 THR A 2 ? ? 48.99 -177.73 62 8 PHE A 33 ? ? 65.46 -168.20 63 8 ILE A 34 ? ? -54.26 104.42 64 8 ASN A 55 ? ? 63.37 73.00 65 8 SER A 75 ? ? -129.37 -73.13 66 8 LEU A 101 ? ? 68.27 132.79 67 8 ALA A 103 ? ? 59.19 -79.82 68 8 LEU A 115 ? ? 57.10 -88.31 69 9 SER A 37 ? ? -45.87 107.12 70 9 GLU A 64 ? ? 69.43 141.52 71 9 PRO A 65 ? ? -61.59 77.45 72 9 ARG A 76 ? ? 62.97 -75.18 73 9 ALA A 79 ? ? 62.87 111.42 74 9 PRO A 82 ? ? -69.61 88.31 75 9 ASP A 104 ? ? -133.56 -31.79 76 9 VAL A 106 ? ? 65.68 146.04 77 9 PRO A 107 ? ? -33.31 99.37 78 10 THR A 2 ? ? 174.86 -169.91 79 10 LEU A 36 ? ? -134.64 -69.76 80 10 SER A 37 ? ? 76.89 165.25 81 10 ARG A 51 ? ? -24.01 -51.62 82 10 ASN A 55 ? ? -175.39 22.61 83 10 ALA A 63 ? ? -53.37 -74.09 84 10 GLU A 64 ? ? 59.18 161.52 85 10 LEU A 66 ? ? 34.61 33.71 86 10 ARG A 76 ? ? -64.94 98.03 87 11 HIS A 35 ? ? 49.59 88.74 88 11 PHE A 50 ? ? -102.45 60.18 89 11 ALA A 54 ? ? -108.90 -66.82 90 11 TRP A 72 ? ? -69.55 94.33 91 11 ARG A 76 ? ? -54.07 97.75 92 11 PRO A 82 ? ? -63.24 97.22 93 11 ASP A 100 ? ? -127.71 -161.49 94 11 ALA A 103 ? ? 60.83 -78.19 95 11 LEU A 109 ? ? -65.13 6.39 96 11 ALA A 114 ? ? -91.83 -83.17 97 11 LEU A 115 ? ? 58.36 172.61 98 12 THR A 2 ? ? 54.97 128.17 99 12 SER A 37 ? ? 73.46 154.95 100 12 PHE A 50 ? ? -144.71 -69.65 101 12 ARG A 51 ? ? -57.99 93.00 102 12 ALA A 79 ? ? 66.14 95.93 103 12 TYR A 85 ? ? -83.26 30.77 104 12 ALA A 103 ? ? 61.50 -82.91 105 12 PRO A 107 ? ? -90.25 50.20 106 13 GLU A 23 ? ? 92.45 156.12 107 13 PHE A 50 ? ? -114.06 59.08 108 13 GLN A 53 ? ? 59.79 -164.08 109 13 ASN A 55 ? ? 57.50 83.12 110 13 ALA A 63 ? ? -79.60 30.54 111 13 PRO A 65 ? ? -70.27 39.21 112 13 GLU A 68 ? ? -152.90 10.61 113 13 SER A 75 ? ? -134.60 -68.76 114 13 ARG A 76 ? ? -106.42 -66.80 115 13 ALA A 79 ? ? 69.70 143.87 116 13 ALA A 103 ? ? 56.63 -83.04 117 13 ALA A 114 ? ? -94.92 -74.80 118 13 LEU A 115 ? ? 61.08 102.47 119 14 ASN A 55 ? ? 58.95 84.10 120 14 GLU A 64 ? ? 63.38 161.86 121 14 LEU A 66 ? ? 19.00 66.03 122 14 GLU A 68 ? ? 78.66 -24.67 123 14 ARG A 76 ? ? 75.18 -47.37 124 14 ALA A 79 ? ? 64.03 -175.15 125 14 PRO A 82 ? ? -69.64 95.06 126 14 LEU A 101 ? ? 65.64 -167.43 127 14 GLN A 108 ? ? -66.30 97.99 128 15 GLU A 23 ? ? -100.69 -75.19 129 15 SER A 25 ? ? -175.69 -164.94 130 15 ILE A 34 ? ? -65.02 87.41 131 15 LYS A 48 ? ? -98.98 -63.05 132 15 PHE A 50 ? ? -97.42 56.10 133 15 ASN A 55 ? ? -171.79 29.90 134 15 TRP A 72 ? ? -69.39 84.57 135 15 ARG A 76 ? ? 63.37 178.52 136 15 LEU A 99 ? ? 60.11 101.64 137 15 ASP A 102 ? ? -111.74 -169.41 138 15 PRO A 107 ? ? -59.44 95.95 139 15 GLN A 108 ? ? -83.83 44.53 140 15 LEU A 109 ? ? -65.12 5.82 141 15 LEU A 113 ? ? -105.59 -159.22 142 15 ALA A 114 ? ? -145.82 -28.71 143 16 GLU A 62 ? ? -69.62 95.77 144 16 GLU A 64 ? ? 64.75 158.35 145 16 ARG A 76 ? ? -58.19 95.64 146 16 ALA A 79 ? ? 62.29 -173.22 147 16 SER A 91 ? ? 56.50 19.85 148 17 ALA A 54 ? ? 55.48 120.85 149 17 ASN A 55 ? ? 64.74 89.44 150 17 GLU A 64 ? ? 68.69 157.43 151 17 LEU A 66 ? ? 70.81 -53.12 152 17 LEU A 70 ? ? -69.27 97.92 153 17 SER A 75 ? ? -110.54 -150.96 154 17 ARG A 76 ? ? -67.54 79.34 155 17 ALA A 103 ? ? -68.40 7.84 156 17 PRO A 107 ? ? -66.52 98.85 157 17 ALA A 114 ? ? 57.59 93.52 158 18 SER A 25 ? ? 179.40 159.34 159 18 ILE A 34 ? ? -50.96 107.09 160 18 SER A 37 ? ? 66.50 97.06 161 18 ARG A 51 ? ? 70.81 -65.54 162 18 ALA A 54 ? ? -102.67 -67.19 163 18 ALA A 63 ? ? -48.39 -70.51 164 18 GLU A 64 ? ? 61.24 167.98 165 18 PRO A 65 ? ? -52.24 5.96 166 18 ARG A 76 ? ? -164.26 -36.38 167 18 PRO A 107 ? ? -59.84 103.97 168 18 LEU A 113 ? ? -104.03 -149.38 169 19 THR A 2 ? ? -171.05 80.04 170 19 GLU A 23 ? ? 73.96 -168.39 171 19 ASN A 55 ? ? 67.56 84.70 172 19 ASP A 69 ? ? -92.79 -64.17 173 19 ARG A 76 ? ? 69.83 -59.99 174 19 ALA A 103 ? ? -58.75 94.02 175 19 ASP A 104 ? ? 91.25 -6.58 176 19 VAL A 106 ? ? 67.13 141.14 177 19 PRO A 107 ? ? -35.01 101.83 178 19 ALA A 114 ? ? 65.94 -72.05 179 20 THR A 2 ? ? -79.14 29.38 180 20 SER A 25 ? ? 170.42 177.48 181 20 LEU A 36 ? ? -145.61 -64.51 182 20 SER A 37 ? ? 78.71 160.29 183 20 PHE A 50 ? ? -112.74 57.12 184 20 ALA A 54 ? ? 64.46 -78.60 185 20 ALA A 63 ? ? -77.16 40.62 186 20 PRO A 65 ? ? -83.75 -157.23 187 20 LEU A 66 ? ? 67.83 -55.38 188 20 ARG A 76 ? ? -55.44 103.45 189 20 LEU A 113 ? ? -93.69 -101.60 190 20 ALA A 114 ? ? 67.76 -33.53 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JQN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 2.1 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.17 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.01 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2JQN _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JQN _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.98 mM [U-100% 13C; U-100% 15N] CcR55, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 10 mM DTT, 0.02% NaN3, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.98 mM [U-100% 13C; U-100% 15N] CcR55, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 10 mM DTT, 0.02% NaN3, 100% D2O' 2 '100% D2O' '0.58 mM [U-5% 13C; U-100% 15N] CcR55, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 10 mM DTT, 0.02% NaN3, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id CcR55 0.98 mM '[U-100% 13C; U-100% 15N]' 1 MES 20 mM ? 1 NaCl 100 mM ? 1 CaCl2 5 mM ? 1 DTT 10 mM ? 1 NaN3 0.02 % ? 1 CcR55 0.98 mM '[U-100% 13C; U-100% 15N]' 2 MES 20 mM ? 2 NaCl 100 mM ? 2 CaCl2 5 mM ? 2 DTT 10 mM ? 2 NaN3 0.02 % ? 2 CcR55 0.58 mM '[U-5% 13C; U-100% 15N]' 3 MES 20 mM ? 3 NaCl 100 mM ? 3 CaCl2 5 mM ? 3 DTT 10 mM ? 3 NaN3 0.02 % ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D 1H-13C NOESY' 1 5 1 '3D 1H-13C NOESY aromatic' 1 6 2 '3D 1H-13C NOESY' 1 7 1 '3D HNCO' 1 8 1 '3D HN(CA)CO' 1 9 1 '3D HN(CO)CA' 1 10 1 '3D HNCA' 1 11 1 '3D GFT HNNCACBCA' 1 12 1 '3D GFT CACB(CO)NHN' 1 13 1 '3D GFT HAHBCACB(CO)NHN' 1 14 1 '3D HCCH-TOCSY' 1 15 1 '3D HCCH-COSY' 1 16 1 '3D CCH-TOCSY' 1 17 1 '3D HNHA' 1 18 3 '2D 1H-13C HSQC high res.' # _pdbx_nmr_details.entry_id 2JQN _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED USING TRIPLE RESONANCE AND GFT NMR SPECTROSCOPY. AUTOMATED BACKBONE ASSIGNMENTS WERE MADE USING AUTOASSIGN, AND THE SIDE CHAIN ASSIGNMENTS WERE COMPLETED MANUALLY. AUTOMATIC NOESY ASSIGNMENTS AS WELL AS DISTANCE, DIHEDRAL ANGLE (HYPER) AND HYDROGEN BOND CONSTRAINTS WERE DETERMINED USING AUTOSTRUCTURE. COMPLETENESS OF NMR ASSIGNMENTS (EXCLUDING C-TERMINAL HHHHHH): BACKBONE, 97.6%, SIDE CHAIN, 96.5%, AROMATICS, 89.1%, STEREOSPECIFIC METHYL, 91.3%. FINAL STRUCTURE QUALITY FACTORS (FOR RESIDUES 1 TO 116, PSVS 1.3), WHERE ORDERED RESIDUES [S(PHI) + S(PSI) > 1.8] COMPRISE: 3-22,26-31,34-35,40-49,56-62,69-73,80-96,109-112: (A) RMSD (ORDERED RESIDUES): BB, 0.9, HEAVY ATOM, 1.3. (B) RAMACHANDRAN STATISTICS FOR ORDERED RESIDUES: MOST FAVORED, 91.3%, ADDITIONALLY ALLOWED, 8.7%, GENEROUSLY ALLOWED, 0.0%, DISALLOWED, 0.0%. (C) PROCHECK SCORES FOR ORDERED RESIDUES (RAW/Z-): PHI-PSI, -0.25/-0.67, ALL, -0.15/-0.89. (D) MOLPROBITY CLASH SCORE (RAW/Z-): 19.99/-1.90. (E) RPF SCORES FOR GOODNESS OF FIT TO NOESY DATA (RESIDUES 1-116): RECALL, 0.985, PRECISION, 0.900, F-MEASURE, 0.941, DP-SCORE, 0.755. THE C-TERMINAL HIS TAG RESIDUES OF THE PROTEIN (HHHHHH) WERE INCLUDED IN ALL STRUCTURE CALCULATIONS BUT HAVE BEEN OMITTED FROM THIS DEPOSITION. COORDINATES FOR THE FOLLOWING RESIDUES ARE NOT WELL DETERMINED (S(PHI) + S(PSI) < 1.8): 1-2,23-25,32-33,36-39,50-55,63-68,74-79,97-108,113-116. ; # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JQN _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1164 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 221 _pdbx_nmr_constraints.NOE_long_range_total_count 375 _pdbx_nmr_constraints.NOE_medium_range_total_count 244 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 324 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2JQN _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 1164 CONFORMATIONALLY-RESTRICTING NOE-DERIVED DISTANCE CONSTRAINTS, 108 DIHEDRAL ANGLE CONSTRAINTS, AND 66 HYDROGEN BOND CONSTRAINTS (11.7 CONSTRAINTS PER RESIDUE, 3.6 LONG RANGE CONSTRAINTS PER RESIDUE, COMPUTED FOR RESIDUES 1 TO 116 BY PSVS 1.3). STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING AUTOSTRUCTURE (XPLOR-NIH). AFTER A FINAL XPLOR CALCULATION USING THE CONSTRAINTS DERIVED FROM AUTOSTRUCTURE, THE 20 LOWEST ENERGY STRUCTURES OUT OF 100 WERE FURTHER REFINED BY RESTRAINED MOLECULAR DYANMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS). ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 1.3 1 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.2.1 2 Goddard 'peak picking' Sparky 3.110 3 Goddard 'data analysis' Sparky 3.110 4 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure 2.1.1 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 6 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.11.2 7 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.11.2 8 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.1 9 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 10 'Bhattacharya and Montelione' 'data analysis' PSVS 1.3 11 'Tejero and Montelione' 'pdb analysis' PdbStat 5.0 12 Varian collection VNMR 6.1C 13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 117 ? A HIS 117 2 1 Y 1 A HIS 118 ? A HIS 118 3 1 Y 1 A HIS 119 ? A HIS 119 4 1 Y 1 A HIS 120 ? A HIS 120 5 1 Y 1 A HIS 121 ? A HIS 121 6 1 Y 1 A HIS 122 ? A HIS 122 7 2 Y 1 A HIS 117 ? A HIS 117 8 2 Y 1 A HIS 118 ? A HIS 118 9 2 Y 1 A HIS 119 ? A HIS 119 10 2 Y 1 A HIS 120 ? A HIS 120 11 2 Y 1 A HIS 121 ? A HIS 121 12 2 Y 1 A HIS 122 ? A HIS 122 13 3 Y 1 A HIS 117 ? A HIS 117 14 3 Y 1 A HIS 118 ? A HIS 118 15 3 Y 1 A HIS 119 ? A HIS 119 16 3 Y 1 A HIS 120 ? A HIS 120 17 3 Y 1 A HIS 121 ? A HIS 121 18 3 Y 1 A HIS 122 ? A HIS 122 19 4 Y 1 A HIS 117 ? A HIS 117 20 4 Y 1 A HIS 118 ? A HIS 118 21 4 Y 1 A HIS 119 ? A HIS 119 22 4 Y 1 A HIS 120 ? A HIS 120 23 4 Y 1 A HIS 121 ? A HIS 121 24 4 Y 1 A HIS 122 ? A HIS 122 25 5 Y 1 A HIS 117 ? A HIS 117 26 5 Y 1 A HIS 118 ? A HIS 118 27 5 Y 1 A HIS 119 ? A HIS 119 28 5 Y 1 A HIS 120 ? A HIS 120 29 5 Y 1 A HIS 121 ? A HIS 121 30 5 Y 1 A HIS 122 ? A HIS 122 31 6 Y 1 A HIS 117 ? A HIS 117 32 6 Y 1 A HIS 118 ? A HIS 118 33 6 Y 1 A HIS 119 ? A HIS 119 34 6 Y 1 A HIS 120 ? A HIS 120 35 6 Y 1 A HIS 121 ? A HIS 121 36 6 Y 1 A HIS 122 ? A HIS 122 37 7 Y 1 A HIS 117 ? A HIS 117 38 7 Y 1 A HIS 118 ? A HIS 118 39 7 Y 1 A HIS 119 ? A HIS 119 40 7 Y 1 A HIS 120 ? A HIS 120 41 7 Y 1 A HIS 121 ? A HIS 121 42 7 Y 1 A HIS 122 ? A HIS 122 43 8 Y 1 A HIS 117 ? A HIS 117 44 8 Y 1 A HIS 118 ? A HIS 118 45 8 Y 1 A HIS 119 ? A HIS 119 46 8 Y 1 A HIS 120 ? A HIS 120 47 8 Y 1 A HIS 121 ? A HIS 121 48 8 Y 1 A HIS 122 ? A HIS 122 49 9 Y 1 A HIS 117 ? A HIS 117 50 9 Y 1 A HIS 118 ? A HIS 118 51 9 Y 1 A HIS 119 ? A HIS 119 52 9 Y 1 A HIS 120 ? A HIS 120 53 9 Y 1 A HIS 121 ? A HIS 121 54 9 Y 1 A HIS 122 ? A HIS 122 55 10 Y 1 A HIS 117 ? A HIS 117 56 10 Y 1 A HIS 118 ? A HIS 118 57 10 Y 1 A HIS 119 ? A HIS 119 58 10 Y 1 A HIS 120 ? A HIS 120 59 10 Y 1 A HIS 121 ? A HIS 121 60 10 Y 1 A HIS 122 ? A HIS 122 61 11 Y 1 A HIS 117 ? A HIS 117 62 11 Y 1 A HIS 118 ? A HIS 118 63 11 Y 1 A HIS 119 ? A HIS 119 64 11 Y 1 A HIS 120 ? A HIS 120 65 11 Y 1 A HIS 121 ? A HIS 121 66 11 Y 1 A HIS 122 ? A HIS 122 67 12 Y 1 A HIS 117 ? A HIS 117 68 12 Y 1 A HIS 118 ? A HIS 118 69 12 Y 1 A HIS 119 ? A HIS 119 70 12 Y 1 A HIS 120 ? A HIS 120 71 12 Y 1 A HIS 121 ? A HIS 121 72 12 Y 1 A HIS 122 ? A HIS 122 73 13 Y 1 A HIS 117 ? A HIS 117 74 13 Y 1 A HIS 118 ? A HIS 118 75 13 Y 1 A HIS 119 ? A HIS 119 76 13 Y 1 A HIS 120 ? A HIS 120 77 13 Y 1 A HIS 121 ? A HIS 121 78 13 Y 1 A HIS 122 ? A HIS 122 79 14 Y 1 A HIS 117 ? A HIS 117 80 14 Y 1 A HIS 118 ? A HIS 118 81 14 Y 1 A HIS 119 ? A HIS 119 82 14 Y 1 A HIS 120 ? A HIS 120 83 14 Y 1 A HIS 121 ? A HIS 121 84 14 Y 1 A HIS 122 ? A HIS 122 85 15 Y 1 A HIS 117 ? A HIS 117 86 15 Y 1 A HIS 118 ? A HIS 118 87 15 Y 1 A HIS 119 ? A HIS 119 88 15 Y 1 A HIS 120 ? A HIS 120 89 15 Y 1 A HIS 121 ? A HIS 121 90 15 Y 1 A HIS 122 ? A HIS 122 91 16 Y 1 A HIS 117 ? A HIS 117 92 16 Y 1 A HIS 118 ? A HIS 118 93 16 Y 1 A HIS 119 ? A HIS 119 94 16 Y 1 A HIS 120 ? A HIS 120 95 16 Y 1 A HIS 121 ? A HIS 121 96 16 Y 1 A HIS 122 ? A HIS 122 97 17 Y 1 A HIS 117 ? A HIS 117 98 17 Y 1 A HIS 118 ? A HIS 118 99 17 Y 1 A HIS 119 ? A HIS 119 100 17 Y 1 A HIS 120 ? A HIS 120 101 17 Y 1 A HIS 121 ? A HIS 121 102 17 Y 1 A HIS 122 ? A HIS 122 103 18 Y 1 A HIS 117 ? A HIS 117 104 18 Y 1 A HIS 118 ? A HIS 118 105 18 Y 1 A HIS 119 ? A HIS 119 106 18 Y 1 A HIS 120 ? A HIS 120 107 18 Y 1 A HIS 121 ? A HIS 121 108 18 Y 1 A HIS 122 ? A HIS 122 109 19 Y 1 A HIS 117 ? A HIS 117 110 19 Y 1 A HIS 118 ? A HIS 118 111 19 Y 1 A HIS 119 ? A HIS 119 112 19 Y 1 A HIS 120 ? A HIS 120 113 19 Y 1 A HIS 121 ? A HIS 121 114 19 Y 1 A HIS 122 ? A HIS 122 115 20 Y 1 A HIS 117 ? A HIS 117 116 20 Y 1 A HIS 118 ? A HIS 118 117 20 Y 1 A HIS 119 ? A HIS 119 118 20 Y 1 A HIS 120 ? A HIS 120 119 20 Y 1 A HIS 121 ? A HIS 121 120 20 Y 1 A HIS 122 ? A HIS 122 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 600 Bruker AVANCE 2 'Bruker Avance' 800 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2JQN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_