data_2JRJ # _entry.id 2JRJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JRJ pdb_00002jrj 10.2210/pdb2jrj/pdb RCSB RCSB100199 ? ? WWPDB D_1000100199 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-10 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_conn.pdbx_dist_value' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 20 5 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JRJ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-27 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id HT2B _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sheng, Y.' 1 'Lemak, A.' 2 'Laister, R.C.' 3 'Wu, B.' 4 'Arrowsmith, C.H.' 5 'Northeast Structural Genomics Consortium (NESG)' 6 # _citation.id primary _citation.title 'Molecular basis of Pirh2-mediated p53 ubiquitylation.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 15 _citation.page_first 1334 _citation.page_last 1342 _citation.year 2008 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19043414 _citation.pdbx_database_id_DOI 10.1038/nsmb.1521 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sheng, Y.' 1 ? primary 'Laister, R.C.' 2 ? primary 'Lemak, A.' 3 ? primary 'Wu, B.' 4 ? primary 'Tai, E.' 5 ? primary 'Duan, S.' 6 ? primary 'Lukin, J.' 7 ? primary 'Sunnerhagen, M.' 8 ? primary 'Srisailam, S.' 9 ? primary 'Karra, M.' 10 ? primary 'Benchimol, S.' 11 ? primary 'Arrowsmith, C.H.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ring finger and CHY zinc finger domain containing protein 1' 6003.978 1 ? ? 'Pirh2 RING-H2 domain: Residues 138-189' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS _entity_poly.pdbx_seq_one_letter_code_can ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HT2B # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASN n 1 3 VAL n 1 4 SER n 1 5 GLN n 1 6 GLN n 1 7 ASN n 1 8 CYS n 1 9 PRO n 1 10 ILE n 1 11 CYS n 1 12 LEU n 1 13 GLU n 1 14 ASP n 1 15 ILE n 1 16 HIS n 1 17 THR n 1 18 SER n 1 19 ARG n 1 20 VAL n 1 21 VAL n 1 22 ALA n 1 23 HIS n 1 24 VAL n 1 25 LEU n 1 26 PRO n 1 27 CYS n 1 28 GLY n 1 29 HIS n 1 30 LEU n 1 31 LEU n 1 32 HIS n 1 33 ARG n 1 34 THR n 1 35 CYS n 1 36 TYR n 1 37 GLU n 1 38 GLU n 1 39 MET n 1 40 LEU n 1 41 LYS n 1 42 GLU n 1 43 GLY n 1 44 TYR n 1 45 ARG n 1 46 CYS n 1 47 PRO n 1 48 LEU n 1 49 CYS n 1 50 MET n 1 51 HIS n 1 52 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene RCHY1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 10 10 GLU GLU A . n A 1 2 ASN 2 11 11 ASN ASN A . n A 1 3 VAL 3 12 12 VAL VAL A . n A 1 4 SER 4 13 13 SER SER A . n A 1 5 GLN 5 14 14 GLN GLN A . n A 1 6 GLN 6 15 15 GLN GLN A . n A 1 7 ASN 7 16 16 ASN ASN A . n A 1 8 CYS 8 17 17 CYS CYS A . n A 1 9 PRO 9 18 18 PRO PRO A . n A 1 10 ILE 10 19 19 ILE ILE A . n A 1 11 CYS 11 20 20 CYS CYS A . n A 1 12 LEU 12 21 21 LEU LEU A . n A 1 13 GLU 13 22 22 GLU GLU A . n A 1 14 ASP 14 23 23 ASP ASP A . n A 1 15 ILE 15 24 24 ILE ILE A . n A 1 16 HIS 16 25 25 HIS HIS A . n A 1 17 THR 17 26 26 THR THR A . n A 1 18 SER 18 27 27 SER SER A . n A 1 19 ARG 19 28 28 ARG ARG A . n A 1 20 VAL 20 29 29 VAL VAL A . n A 1 21 VAL 21 30 30 VAL VAL A . n A 1 22 ALA 22 31 31 ALA ALA A . n A 1 23 HIS 23 32 32 HIS HIS A . n A 1 24 VAL 24 33 33 VAL VAL A . n A 1 25 LEU 25 34 34 LEU LEU A . n A 1 26 PRO 26 35 35 PRO PRO A . n A 1 27 CYS 27 36 36 CYS CYS A . n A 1 28 GLY 28 37 37 GLY GLY A . n A 1 29 HIS 29 38 38 HIS HIS A . n A 1 30 LEU 30 39 39 LEU LEU A . n A 1 31 LEU 31 40 40 LEU LEU A . n A 1 32 HIS 32 41 41 HIS HIS A . n A 1 33 ARG 33 42 42 ARG ARG A . n A 1 34 THR 34 43 43 THR THR A . n A 1 35 CYS 35 44 44 CYS CYS A . n A 1 36 TYR 36 45 45 TYR TYR A . n A 1 37 GLU 37 46 46 GLU GLU A . n A 1 38 GLU 38 47 47 GLU GLU A . n A 1 39 MET 39 48 48 MET MET A . n A 1 40 LEU 40 49 49 LEU LEU A . n A 1 41 LYS 41 50 50 LYS LYS A . n A 1 42 GLU 42 51 51 GLU GLU A . n A 1 43 GLY 43 52 52 GLY GLY A . n A 1 44 TYR 44 53 53 TYR TYR A . n A 1 45 ARG 45 54 54 ARG ARG A . n A 1 46 CYS 46 55 55 CYS CYS A . n A 1 47 PRO 47 56 56 PRO PRO A . n A 1 48 LEU 48 57 57 LEU LEU A . n A 1 49 CYS 49 58 58 CYS CYS A . n A 1 50 MET 50 59 59 MET MET A . n A 1 51 HIS 51 60 60 HIS HIS A . n A 1 52 SER 52 61 61 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 62 62 ZN ZN A . C 2 ZN 1 63 63 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JRJ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JRJ _struct.title 'Solution structure of the human Pirh2 RING-H2 domain. Northeast Structural Genomics Consortium Target HT2B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JRJ _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;Ubiquitin E3 ligase, RING domain, Structural Genomics, Protein Structure Initiative, PSI-2, Northeast Structural Genomics Consortium, NESG, LIGASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q86X26_HUMAN _struct_ref.pdbx_db_accession Q86X26 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS _struct_ref.pdbx_align_begin 138 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JRJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q86X26 _struct_ref_seq.db_align_beg 138 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 61 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 33 ? GLY A 43 ? ARG A 42 GLY A 52 1 ? 11 HELX_P HELX_P2 2 CYS A 46 ? HIS A 51 ? CYS A 55 HIS A 60 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 62 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 20 A ZN 62 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc3 metalc ? ? A CYS 27 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 36 A ZN 63 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc4 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 38 A ZN 63 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc5 metalc ? ? A HIS 32 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 41 A ZN 62 1_555 ? ? ? ? ? ? ? 2.081 ? ? metalc6 metalc ? ? A CYS 35 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 44 A ZN 62 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc7 metalc ? ? A CYS 46 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 63 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc8 metalc ? ? A CYS 49 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 58 A ZN 63 1_555 ? ? ? ? ? ? ? 2.331 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 11 ? A CYS 20 ? 1_555 111.7 ? 2 SG ? A CYS 8 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 NE2 ? A HIS 32 ? A HIS 41 ? 1_555 107.2 ? 3 SG ? A CYS 11 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 NE2 ? A HIS 32 ? A HIS 41 ? 1_555 109.1 ? 4 SG ? A CYS 8 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 35 ? A CYS 44 ? 1_555 109.2 ? 5 SG ? A CYS 11 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 35 ? A CYS 44 ? 1_555 112.5 ? 6 NE2 ? A HIS 32 ? A HIS 41 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG ? A CYS 35 ? A CYS 44 ? 1_555 107.0 ? 7 SG ? A CYS 27 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 NE2 ? A HIS 29 ? A HIS 38 ? 1_555 106.0 ? 8 SG ? A CYS 27 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 46 ? A CYS 55 ? 1_555 112.6 ? 9 NE2 ? A HIS 29 ? A HIS 38 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 46 ? A CYS 55 ? 1_555 105.6 ? 10 SG ? A CYS 27 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 49 ? A CYS 58 ? 1_555 114.5 ? 11 NE2 ? A HIS 29 ? A HIS 38 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 49 ? A CYS 58 ? 1_555 106.4 ? 12 SG ? A CYS 46 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG ? A CYS 49 ? A CYS 58 ? 1_555 111.0 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 7 ? CYS A 8 ? ASN A 16 CYS A 17 A 2 GLU A 13 ? ASP A 14 ? GLU A 22 ASP A 23 B 1 ALA A 22 ? VAL A 24 ? ALA A 31 VAL A 33 B 2 LEU A 30 ? HIS A 32 ? LEU A 39 HIS A 41 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 8 ? N CYS A 17 O GLU A 13 ? O GLU A 22 B 1 2 N HIS A 23 ? N HIS A 32 O LEU A 31 ? O LEU A 40 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 62 ? 4 'BINDING SITE FOR RESIDUE ZN A 62' AC2 Software A ZN 63 ? 4 'BINDING SITE FOR RESIDUE ZN A 63' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 8 ? CYS A 17 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 20 . ? 1_555 ? 3 AC1 4 HIS A 32 ? HIS A 41 . ? 1_555 ? 4 AC1 4 CYS A 35 ? CYS A 44 . ? 1_555 ? 5 AC2 4 CYS A 27 ? CYS A 36 . ? 1_555 ? 6 AC2 4 HIS A 29 ? HIS A 38 . ? 1_555 ? 7 AC2 4 CYS A 46 ? CYS A 55 . ? 1_555 ? 8 AC2 4 CYS A 49 ? CYS A 58 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 20 ? ? -161.69 18.15 2 2 ASN A 11 ? ? 60.53 91.76 3 2 SER A 13 ? ? -68.47 83.53 4 2 GLN A 14 ? ? -165.86 93.83 5 2 CYS A 20 ? ? -157.10 12.12 6 2 CYS A 55 ? ? -54.59 108.24 7 3 LEU A 21 ? ? 52.41 72.28 8 3 SER A 27 ? ? -52.35 106.42 9 3 CYS A 55 ? ? -54.26 109.62 10 4 CYS A 20 ? ? -156.70 18.40 11 4 SER A 27 ? ? -57.54 99.45 12 5 CYS A 20 ? ? -164.12 17.49 13 6 CYS A 20 ? ? -165.21 22.77 14 6 SER A 27 ? ? -59.63 104.89 15 7 ASN A 11 ? ? -160.16 66.70 16 7 CYS A 20 ? ? -165.15 20.41 17 7 LEU A 21 ? ? 55.73 89.65 18 7 SER A 27 ? ? -66.30 97.21 19 8 CYS A 20 ? ? -171.68 19.36 20 8 CYS A 55 ? ? -54.14 109.72 21 9 ASN A 11 ? ? -177.26 126.58 22 9 SER A 13 ? ? -168.21 118.71 23 9 CYS A 20 ? ? -166.42 25.41 24 9 SER A 27 ? ? -58.23 106.81 25 9 CYS A 55 ? ? -55.63 107.83 26 10 CYS A 20 ? ? -173.55 22.49 27 11 VAL A 12 ? ? -115.49 79.15 28 11 CYS A 20 ? ? -157.57 16.96 29 11 CYS A 55 ? ? -53.91 108.28 30 12 ASN A 11 ? ? 69.44 89.20 31 12 CYS A 20 ? ? -164.81 18.22 32 12 LEU A 21 ? ? 49.91 83.68 33 12 SER A 27 ? ? -45.47 108.52 34 12 CYS A 55 ? ? -55.68 108.80 35 13 CYS A 20 ? ? -158.08 14.76 36 14 CYS A 20 ? ? -161.16 10.81 37 14 LEU A 21 ? ? 54.76 94.12 38 14 SER A 27 ? ? -48.73 86.79 39 15 VAL A 12 ? ? -73.75 -77.13 40 15 CYS A 20 ? ? -163.09 22.62 41 15 SER A 27 ? ? -61.65 93.88 42 15 VAL A 30 ? ? -99.09 -63.14 43 16 CYS A 20 ? ? -162.18 12.63 44 16 LEU A 21 ? ? 54.97 91.02 45 16 SER A 27 ? ? -57.52 89.91 46 17 CYS A 20 ? ? -163.61 17.69 47 17 LEU A 21 ? ? 49.08 80.00 48 17 SER A 27 ? ? -60.12 94.52 49 18 GLN A 15 ? ? -69.04 87.69 50 18 CYS A 20 ? ? -167.87 21.95 51 18 SER A 27 ? ? -64.74 89.47 52 19 ASN A 11 ? ? -59.64 88.46 53 19 CYS A 20 ? ? -168.31 20.50 54 19 LEU A 21 ? ? 48.26 72.72 55 19 SER A 27 ? ? -55.40 98.69 56 19 PRO A 35 ? ? -64.11 1.15 57 20 CYS A 20 ? ? -155.59 12.10 58 20 LEU A 21 ? ? 52.37 79.56 59 20 SER A 27 ? ? -59.80 99.51 60 20 HIS A 60 ? ? 64.49 121.11 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JRJ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JRJ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.7 mM [U-13C; U-15N] Pirh2 RING domain, 25 mM sodium phosphate, 150 mM potassium chloride, 10 uM ZnCl2, 2 mM [U-99% 2H] DTT, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.7 mM [U-13C; U-15N] Pirh2 RING domain, 25 mM sodium phosphate, 150 mM potassium chloride, 10 uM ZnCl2, 2 mM [U-99% 2H] DTT, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Pirh2 RING domain' 0.7 mM '[U-13C; U-15N]' 1 'sodium phosphate' 25 mM ? 1 'potassium chloride' 150 mM ? 1 ZnCl2 10 uM ? 1 DTT 2 mM '[U-99% 2H]' 1 'Pirh2 RING domain' 0.7 mM '[U-13C; U-15N]' 2 'sodium phosphate' 25 mM ? 2 'potassium chloride' 150 mM ? 2 ZnCl2 10 uM ? 2 DTT 2 mM '[U-99% 2H]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D C(CO)NH' 1 2 1 '3D HNCACB' 1 3 1 '3D H(CCO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D 1H-15N NOESY' 1 6 2 '3D 1H-13C NOESY' 1 7 2 '3D HCCH-TOCSY' 1 8 2 '3D 1H-13C_aromatic NOESY' # _pdbx_nmr_refine.entry_id 2JRJ _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Bartels et al.' 'peak picking' XEASY ? 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PRO N N N N 247 PRO CA C N S 248 PRO C C N N 249 PRO O O N N 250 PRO CB C N N 251 PRO CG C N N 252 PRO CD C N N 253 PRO OXT O N N 254 PRO H H N N 255 PRO HA H N N 256 PRO HB2 H N N 257 PRO HB3 H N N 258 PRO HG2 H N N 259 PRO HG3 H N N 260 PRO HD2 H N N 261 PRO HD3 H N N 262 PRO HXT H N N 263 SER N N N N 264 SER CA C N S 265 SER C C N N 266 SER O O N N 267 SER CB C N N 268 SER OG O N N 269 SER OXT O N N 270 SER H H N N 271 SER H2 H N N 272 SER HA H N N 273 SER HB2 H N N 274 SER HB3 H N N 275 SER HG H N N 276 SER HXT H N N 277 THR N N N N 278 THR CA C N S 279 THR C C N N 280 THR O O N N 281 THR CB C N R 282 THR OG1 O N N 283 THR CG2 C N N 284 THR OXT O N N 285 THR H H N N 286 THR H2 H N N 287 THR HA H N N 288 THR HB H N N 289 THR HG1 H N N 290 THR HG21 H N N 291 THR HG22 H N N 292 THR HG23 H N N 293 THR HXT H N N 294 TYR N N N N 295 TYR CA C N S 296 TYR C C N N 297 TYR O O N N 298 TYR CB C N N 299 TYR CG C Y N 300 TYR CD1 C Y N 301 TYR CD2 C Y N 302 TYR CE1 C Y N 303 TYR CE2 C Y N 304 TYR CZ C Y N 305 TYR OH O N N 306 TYR OXT O N N 307 TYR H H N N 308 TYR H2 H N N 309 TYR HA H N N 310 TYR HB2 H N N 311 TYR HB3 H N N 312 TYR HD1 H N N 313 TYR HD2 H N N 314 TYR HE1 H N N 315 TYR HE2 H N N 316 TYR HH H N N 317 TYR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 ZN ZN ZN N N 338 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PRO N CA sing N N 235 PRO N CD sing N N 236 PRO N H sing N N 237 PRO CA C sing N N 238 PRO CA CB sing N N 239 PRO CA HA sing N N 240 PRO C O doub N N 241 PRO C OXT sing N N 242 PRO CB CG sing N N 243 PRO CB HB2 sing N N 244 PRO CB HB3 sing N N 245 PRO CG CD sing N N 246 PRO CG HG2 sing N N 247 PRO CG HG3 sing N N 248 PRO CD HD2 sing N N 249 PRO CD HD3 sing N N 250 PRO OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 TYR N CA sing N N 281 TYR N H sing N N 282 TYR N H2 sing N N 283 TYR CA C sing N N 284 TYR CA CB sing N N 285 TYR CA HA sing N N 286 TYR C O doub N N 287 TYR C OXT sing N N 288 TYR CB CG sing N N 289 TYR CB HB2 sing N N 290 TYR CB HB3 sing N N 291 TYR CG CD1 doub Y N 292 TYR CG CD2 sing Y N 293 TYR CD1 CE1 sing Y N 294 TYR CD1 HD1 sing N N 295 TYR CD2 CE2 doub Y N 296 TYR CD2 HD2 sing N N 297 TYR CE1 CZ doub Y N 298 TYR CE1 HE1 sing N N 299 TYR CE2 CZ sing Y N 300 TYR CE2 HE2 sing N N 301 TYR CZ OH sing N N 302 TYR OH HH sing N N 303 TYR OXT HXT sing N N 304 VAL N CA sing N N 305 VAL N H sing N N 306 VAL N H2 sing N N 307 VAL CA C sing N N 308 VAL CA CB sing N N 309 VAL CA HA sing N N 310 VAL C O doub N N 311 VAL C OXT sing N N 312 VAL CB CG1 sing N N 313 VAL CB CG2 sing N N 314 VAL CB HB sing N N 315 VAL CG1 HG11 sing N N 316 VAL CG1 HG12 sing N N 317 VAL CG1 HG13 sing N N 318 VAL CG2 HG21 sing N N 319 VAL CG2 HG22 sing N N 320 VAL CG2 HG23 sing N N 321 VAL OXT HXT sing N N 322 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2JRJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_