data_2JRJ
# 
_entry.id   2JRJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2JRJ         pdb_00002jrj 10.2210/pdb2jrj/pdb 
RCSB  RCSB100199   ?            ?                   
WWPDB D_1000100199 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-07-10 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-09 
5 'Structure model' 1 4 2023-12-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_spectrometer 
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
5 4 'Structure model' struct_conn           
6 4 'Structure model' struct_site           
7 5 'Structure model' chem_comp_atom        
8 5 'Structure model' chem_comp_bond        
9 5 'Structure model' pdbx_database_status  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                
2  4 'Structure model' '_database_2.pdbx_database_accession' 
3  4 'Structure model' '_pdbx_nmr_spectrometer.model'        
4  4 'Structure model' '_struct_conn.pdbx_dist_value'        
5  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
6  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
7  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
8  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
9  4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
17 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
18 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
19 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
20 5 'Structure model' '_pdbx_database_status.deposit_site'  
# 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.entry_id                        2JRJ 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-27 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          HT2B 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sheng, Y.'                                       1 
'Lemak, A.'                                       2 
'Laister, R.C.'                                   3 
'Wu, B.'                                          4 
'Arrowsmith, C.H.'                                5 
'Northeast Structural Genomics Consortium (NESG)' 6 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis of Pirh2-mediated p53 ubiquitylation.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            15 
_citation.page_first                1334 
_citation.page_last                 1342 
_citation.year                      2008 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19043414 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1521 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sheng, Y.'        1  ? 
primary 'Laister, R.C.'    2  ? 
primary 'Lemak, A.'        3  ? 
primary 'Wu, B.'           4  ? 
primary 'Tai, E.'          5  ? 
primary 'Duan, S.'         6  ? 
primary 'Lukin, J.'        7  ? 
primary 'Sunnerhagen, M.'  8  ? 
primary 'Srisailam, S.'    9  ? 
primary 'Karra, M.'        10 ? 
primary 'Benchimol, S.'    11 ? 
primary 'Arrowsmith, C.H.' 12 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ring finger and CHY zinc finger domain containing protein 1' 6003.978 1 ? ? 
'Pirh2 RING-H2 domain: Residues 138-189' ? 
2 non-polymer syn 'ZINC ION'                                                    65.409   2 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS 
_entity_poly.pdbx_seq_one_letter_code_can   ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         HT2B 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLU n 
1 2  ASN n 
1 3  VAL n 
1 4  SER n 
1 5  GLN n 
1 6  GLN n 
1 7  ASN n 
1 8  CYS n 
1 9  PRO n 
1 10 ILE n 
1 11 CYS n 
1 12 LEU n 
1 13 GLU n 
1 14 ASP n 
1 15 ILE n 
1 16 HIS n 
1 17 THR n 
1 18 SER n 
1 19 ARG n 
1 20 VAL n 
1 21 VAL n 
1 22 ALA n 
1 23 HIS n 
1 24 VAL n 
1 25 LEU n 
1 26 PRO n 
1 27 CYS n 
1 28 GLY n 
1 29 HIS n 
1 30 LEU n 
1 31 LEU n 
1 32 HIS n 
1 33 ARG n 
1 34 THR n 
1 35 CYS n 
1 36 TYR n 
1 37 GLU n 
1 38 GLU n 
1 39 MET n 
1 40 LEU n 
1 41 LYS n 
1 42 GLU n 
1 43 GLY n 
1 44 TYR n 
1 45 ARG n 
1 46 CYS n 
1 47 PRO n 
1 48 LEU n 
1 49 CYS n 
1 50 MET n 
1 51 HIS n 
1 52 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 RCHY1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLU 1  10 10 GLU GLU A . n 
A 1 2  ASN 2  11 11 ASN ASN A . n 
A 1 3  VAL 3  12 12 VAL VAL A . n 
A 1 4  SER 4  13 13 SER SER A . n 
A 1 5  GLN 5  14 14 GLN GLN A . n 
A 1 6  GLN 6  15 15 GLN GLN A . n 
A 1 7  ASN 7  16 16 ASN ASN A . n 
A 1 8  CYS 8  17 17 CYS CYS A . n 
A 1 9  PRO 9  18 18 PRO PRO A . n 
A 1 10 ILE 10 19 19 ILE ILE A . n 
A 1 11 CYS 11 20 20 CYS CYS A . n 
A 1 12 LEU 12 21 21 LEU LEU A . n 
A 1 13 GLU 13 22 22 GLU GLU A . n 
A 1 14 ASP 14 23 23 ASP ASP A . n 
A 1 15 ILE 15 24 24 ILE ILE A . n 
A 1 16 HIS 16 25 25 HIS HIS A . n 
A 1 17 THR 17 26 26 THR THR A . n 
A 1 18 SER 18 27 27 SER SER A . n 
A 1 19 ARG 19 28 28 ARG ARG A . n 
A 1 20 VAL 20 29 29 VAL VAL A . n 
A 1 21 VAL 21 30 30 VAL VAL A . n 
A 1 22 ALA 22 31 31 ALA ALA A . n 
A 1 23 HIS 23 32 32 HIS HIS A . n 
A 1 24 VAL 24 33 33 VAL VAL A . n 
A 1 25 LEU 25 34 34 LEU LEU A . n 
A 1 26 PRO 26 35 35 PRO PRO A . n 
A 1 27 CYS 27 36 36 CYS CYS A . n 
A 1 28 GLY 28 37 37 GLY GLY A . n 
A 1 29 HIS 29 38 38 HIS HIS A . n 
A 1 30 LEU 30 39 39 LEU LEU A . n 
A 1 31 LEU 31 40 40 LEU LEU A . n 
A 1 32 HIS 32 41 41 HIS HIS A . n 
A 1 33 ARG 33 42 42 ARG ARG A . n 
A 1 34 THR 34 43 43 THR THR A . n 
A 1 35 CYS 35 44 44 CYS CYS A . n 
A 1 36 TYR 36 45 45 TYR TYR A . n 
A 1 37 GLU 37 46 46 GLU GLU A . n 
A 1 38 GLU 38 47 47 GLU GLU A . n 
A 1 39 MET 39 48 48 MET MET A . n 
A 1 40 LEU 40 49 49 LEU LEU A . n 
A 1 41 LYS 41 50 50 LYS LYS A . n 
A 1 42 GLU 42 51 51 GLU GLU A . n 
A 1 43 GLY 43 52 52 GLY GLY A . n 
A 1 44 TYR 44 53 53 TYR TYR A . n 
A 1 45 ARG 45 54 54 ARG ARG A . n 
A 1 46 CYS 46 55 55 CYS CYS A . n 
A 1 47 PRO 47 56 56 PRO PRO A . n 
A 1 48 LEU 48 57 57 LEU LEU A . n 
A 1 49 CYS 49 58 58 CYS CYS A . n 
A 1 50 MET 50 59 59 MET MET A . n 
A 1 51 HIS 51 60 60 HIS HIS A . n 
A 1 52 SER 52 61 61 SER SER A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN 1 62 62 ZN ZN A . 
C 2 ZN 1 63 63 ZN ZN A . 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JRJ 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2JRJ 
_struct.title                     
'Solution structure of the human Pirh2 RING-H2 domain. Northeast Structural Genomics Consortium Target HT2B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JRJ 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
;Ubiquitin E3 ligase, RING domain, Structural Genomics, Protein Structure Initiative, PSI-2, Northeast Structural Genomics Consortium, NESG, LIGASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q86X26_HUMAN 
_struct_ref.pdbx_db_accession          Q86X26 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS 
_struct_ref.pdbx_align_begin           138 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JRJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 52 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q86X26 
_struct_ref_seq.db_align_beg                  138 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  189 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       10 
_struct_ref_seq.pdbx_auth_seq_align_end       61 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 33 ? GLY A 43 ? ARG A 42 GLY A 52 1 ? 11 
HELX_P HELX_P2 2 CYS A 46 ? HIS A 51 ? CYS A 55 HIS A 60 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 8  SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 62 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc2 metalc ? ? A CYS 11 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 20 A ZN 62 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc3 metalc ? ? A CYS 27 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 36 A ZN 63 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc4 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 38 A ZN 63 1_555 ? ? ? ? ? ? ? 2.061 ? ? 
metalc5 metalc ? ? A HIS 32 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 41 A ZN 62 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc6 metalc ? ? A CYS 35 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 44 A ZN 62 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc7 metalc ? ? A CYS 46 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 63 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc8 metalc ? ? A CYS 49 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 58 A ZN 63 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 8  ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 11 ? A CYS 20 ? 1_555 111.7 ? 
2  SG  ? A CYS 8  ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 NE2 ? A HIS 32 ? A HIS 41 ? 1_555 107.2 ? 
3  SG  ? A CYS 11 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 NE2 ? A HIS 32 ? A HIS 41 ? 1_555 109.1 ? 
4  SG  ? A CYS 8  ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 35 ? A CYS 44 ? 1_555 109.2 ? 
5  SG  ? A CYS 11 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 35 ? A CYS 44 ? 1_555 112.5 ? 
6  NE2 ? A HIS 32 ? A HIS 41 ? 1_555 ZN ? B ZN . ? A ZN 62 ? 1_555 SG  ? A CYS 35 ? A CYS 44 ? 1_555 107.0 ? 
7  SG  ? A CYS 27 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 NE2 ? A HIS 29 ? A HIS 38 ? 1_555 106.0 ? 
8  SG  ? A CYS 27 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 46 ? A CYS 55 ? 1_555 112.6 ? 
9  NE2 ? A HIS 29 ? A HIS 38 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 46 ? A CYS 55 ? 1_555 105.6 ? 
10 SG  ? A CYS 27 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 49 ? A CYS 58 ? 1_555 114.5 ? 
11 NE2 ? A HIS 29 ? A HIS 38 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 49 ? A CYS 58 ? 1_555 106.4 ? 
12 SG  ? A CYS 46 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 63 ? 1_555 SG  ? A CYS 49 ? A CYS 58 ? 1_555 111.0 ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 7  ? CYS A 8  ? ASN A 16 CYS A 17 
A 2 GLU A 13 ? ASP A 14 ? GLU A 22 ASP A 23 
B 1 ALA A 22 ? VAL A 24 ? ALA A 31 VAL A 33 
B 2 LEU A 30 ? HIS A 32 ? LEU A 39 HIS A 41 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 8  ? N CYS A 17 O GLU A 13 ? O GLU A 22 
B 1 2 N HIS A 23 ? N HIS A 32 O LEU A 31 ? O LEU A 40 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 62 ? 4 'BINDING SITE FOR RESIDUE ZN A 62' 
AC2 Software A ZN 63 ? 4 'BINDING SITE FOR RESIDUE ZN A 63' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 8  ? CYS A 17 . ? 1_555 ? 
2 AC1 4 CYS A 11 ? CYS A 20 . ? 1_555 ? 
3 AC1 4 HIS A 32 ? HIS A 41 . ? 1_555 ? 
4 AC1 4 CYS A 35 ? CYS A 44 . ? 1_555 ? 
5 AC2 4 CYS A 27 ? CYS A 36 . ? 1_555 ? 
6 AC2 4 HIS A 29 ? HIS A 38 . ? 1_555 ? 
7 AC2 4 CYS A 46 ? CYS A 55 . ? 1_555 ? 
8 AC2 4 CYS A 49 ? CYS A 58 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  CYS A 20 ? ? -161.69 18.15  
2  2  ASN A 11 ? ? 60.53   91.76  
3  2  SER A 13 ? ? -68.47  83.53  
4  2  GLN A 14 ? ? -165.86 93.83  
5  2  CYS A 20 ? ? -157.10 12.12  
6  2  CYS A 55 ? ? -54.59  108.24 
7  3  LEU A 21 ? ? 52.41   72.28  
8  3  SER A 27 ? ? -52.35  106.42 
9  3  CYS A 55 ? ? -54.26  109.62 
10 4  CYS A 20 ? ? -156.70 18.40  
11 4  SER A 27 ? ? -57.54  99.45  
12 5  CYS A 20 ? ? -164.12 17.49  
13 6  CYS A 20 ? ? -165.21 22.77  
14 6  SER A 27 ? ? -59.63  104.89 
15 7  ASN A 11 ? ? -160.16 66.70  
16 7  CYS A 20 ? ? -165.15 20.41  
17 7  LEU A 21 ? ? 55.73   89.65  
18 7  SER A 27 ? ? -66.30  97.21  
19 8  CYS A 20 ? ? -171.68 19.36  
20 8  CYS A 55 ? ? -54.14  109.72 
21 9  ASN A 11 ? ? -177.26 126.58 
22 9  SER A 13 ? ? -168.21 118.71 
23 9  CYS A 20 ? ? -166.42 25.41  
24 9  SER A 27 ? ? -58.23  106.81 
25 9  CYS A 55 ? ? -55.63  107.83 
26 10 CYS A 20 ? ? -173.55 22.49  
27 11 VAL A 12 ? ? -115.49 79.15  
28 11 CYS A 20 ? ? -157.57 16.96  
29 11 CYS A 55 ? ? -53.91  108.28 
30 12 ASN A 11 ? ? 69.44   89.20  
31 12 CYS A 20 ? ? -164.81 18.22  
32 12 LEU A 21 ? ? 49.91   83.68  
33 12 SER A 27 ? ? -45.47  108.52 
34 12 CYS A 55 ? ? -55.68  108.80 
35 13 CYS A 20 ? ? -158.08 14.76  
36 14 CYS A 20 ? ? -161.16 10.81  
37 14 LEU A 21 ? ? 54.76   94.12  
38 14 SER A 27 ? ? -48.73  86.79  
39 15 VAL A 12 ? ? -73.75  -77.13 
40 15 CYS A 20 ? ? -163.09 22.62  
41 15 SER A 27 ? ? -61.65  93.88  
42 15 VAL A 30 ? ? -99.09  -63.14 
43 16 CYS A 20 ? ? -162.18 12.63  
44 16 LEU A 21 ? ? 54.97   91.02  
45 16 SER A 27 ? ? -57.52  89.91  
46 17 CYS A 20 ? ? -163.61 17.69  
47 17 LEU A 21 ? ? 49.08   80.00  
48 17 SER A 27 ? ? -60.12  94.52  
49 18 GLN A 15 ? ? -69.04  87.69  
50 18 CYS A 20 ? ? -167.87 21.95  
51 18 SER A 27 ? ? -64.74  89.47  
52 19 ASN A 11 ? ? -59.64  88.46  
53 19 CYS A 20 ? ? -168.31 20.50  
54 19 LEU A 21 ? ? 48.26   72.72  
55 19 SER A 27 ? ? -55.40  98.69  
56 19 PRO A 35 ? ? -64.11  1.15   
57 20 CYS A 20 ? ? -155.59 12.10  
58 20 LEU A 21 ? ? 52.37   79.56  
59 20 SER A 27 ? ? -59.80  99.51  
60 20 HIS A 60 ? ? 64.49   121.11 
# 
_pdbx_SG_project.full_name_of_center   'Northeast Structural Genomics Consortium' 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.initial_of_center     NESG 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JRJ 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JRJ 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.7 mM [U-13C; U-15N] Pirh2 RING domain, 25 mM sodium phosphate, 150 mM potassium chloride, 10 uM ZnCl2, 2 mM [U-99% 2H] DTT, 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;0.7 mM [U-13C; U-15N] Pirh2 RING domain, 25 mM sodium phosphate, 150 mM potassium chloride, 10 uM ZnCl2, 2 mM [U-99% 2H] DTT, 100% D2O
;
2 '100% D2O'        
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
'Pirh2 RING domain'  0.7 mM '[U-13C; U-15N]' 1 
'sodium phosphate'   25  mM ?                1 
'potassium chloride' 150 mM ?                1 
ZnCl2                10  uM ?                1 
DTT                  2   mM '[U-99% 2H]'     1 
'Pirh2 RING domain'  0.7 mM '[U-13C; U-15N]' 2 
'sodium phosphate'   25  mM ?                2 
'potassium chloride' 150 mM ?                2 
ZnCl2                10  uM ?                2 
DTT                  2   mM '[U-99% 2H]'     2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      150 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D C(CO)NH'               
1 2 1 '3D HNCACB'                
1 3 1 '3D H(CCO)NH'              
1 4 1 '3D HNCO'                  
1 5 1 '3D 1H-15N NOESY'          
1 6 2 '3D 1H-13C NOESY'          
1 7 2 '3D HCCH-TOCSY'            
1 8 2 '3D 1H-13C_aromatic NOESY' 
# 
_pdbx_nmr_refine.entry_id           2JRJ 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing           NMRPipe ? 1 
'Bartels et al.'                                    'peak picking'       XEASY   ? 2 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution' CYANA   ? 3 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement           CNS     ? 4 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
ILE N    N  N N 158 
ILE CA   C  N S 159 
ILE C    C  N N 160 
ILE O    O  N N 161 
ILE CB   C  N S 162 
ILE CG1  C  N N 163 
ILE CG2  C  N N 164 
ILE CD1  C  N N 165 
ILE OXT  O  N N 166 
ILE H    H  N N 167 
ILE H2   H  N N 168 
ILE HA   H  N N 169 
ILE HB   H  N N 170 
ILE HG12 H  N N 171 
ILE HG13 H  N N 172 
ILE HG21 H  N N 173 
ILE HG22 H  N N 174 
ILE HG23 H  N N 175 
ILE HD11 H  N N 176 
ILE HD12 H  N N 177 
ILE HD13 H  N N 178 
ILE HXT  H  N N 179 
LEU N    N  N N 180 
LEU CA   C  N S 181 
LEU C    C  N N 182 
LEU O    O  N N 183 
LEU CB   C  N N 184 
LEU CG   C  N N 185 
LEU CD1  C  N N 186 
LEU CD2  C  N N 187 
LEU OXT  O  N N 188 
LEU H    H  N N 189 
LEU H2   H  N N 190 
LEU HA   H  N N 191 
LEU HB2  H  N N 192 
LEU HB3  H  N N 193 
LEU HG   H  N N 194 
LEU HD11 H  N N 195 
LEU HD12 H  N N 196 
LEU HD13 H  N N 197 
LEU HD21 H  N N 198 
LEU HD22 H  N N 199 
LEU HD23 H  N N 200 
LEU HXT  H  N N 201 
LYS N    N  N N 202 
LYS CA   C  N S 203 
LYS C    C  N N 204 
LYS O    O  N N 205 
LYS CB   C  N N 206 
LYS CG   C  N N 207 
LYS CD   C  N N 208 
LYS CE   C  N N 209 
LYS NZ   N  N N 210 
LYS OXT  O  N N 211 
LYS H    H  N N 212 
LYS H2   H  N N 213 
LYS HA   H  N N 214 
LYS HB2  H  N N 215 
LYS HB3  H  N N 216 
LYS HG2  H  N N 217 
LYS HG3  H  N N 218 
LYS HD2  H  N N 219 
LYS HD3  H  N N 220 
LYS HE2  H  N N 221 
LYS HE3  H  N N 222 
LYS HZ1  H  N N 223 
LYS HZ2  H  N N 224 
LYS HZ3  H  N N 225 
LYS HXT  H  N N 226 
MET N    N  N N 227 
MET CA   C  N S 228 
MET C    C  N N 229 
MET O    O  N N 230 
MET CB   C  N N 231 
MET CG   C  N N 232 
MET SD   S  N N 233 
MET CE   C  N N 234 
MET OXT  O  N N 235 
MET H    H  N N 236 
MET H2   H  N N 237 
MET HA   H  N N 238 
MET HB2  H  N N 239 
MET HB3  H  N N 240 
MET HG2  H  N N 241 
MET HG3  H  N N 242 
MET HE1  H  N N 243 
MET HE2  H  N N 244 
MET HE3  H  N N 245 
MET HXT  H  N N 246 
PRO N    N  N N 247 
PRO CA   C  N S 248 
PRO C    C  N N 249 
PRO O    O  N N 250 
PRO CB   C  N N 251 
PRO CG   C  N N 252 
PRO CD   C  N N 253 
PRO OXT  O  N N 254 
PRO H    H  N N 255 
PRO HA   H  N N 256 
PRO HB2  H  N N 257 
PRO HB3  H  N N 258 
PRO HG2  H  N N 259 
PRO HG3  H  N N 260 
PRO HD2  H  N N 261 
PRO HD3  H  N N 262 
PRO HXT  H  N N 263 
SER N    N  N N 264 
SER CA   C  N S 265 
SER C    C  N N 266 
SER O    O  N N 267 
SER CB   C  N N 268 
SER OG   O  N N 269 
SER OXT  O  N N 270 
SER H    H  N N 271 
SER H2   H  N N 272 
SER HA   H  N N 273 
SER HB2  H  N N 274 
SER HB3  H  N N 275 
SER HG   H  N N 276 
SER HXT  H  N N 277 
THR N    N  N N 278 
THR CA   C  N S 279 
THR C    C  N N 280 
THR O    O  N N 281 
THR CB   C  N R 282 
THR OG1  O  N N 283 
THR CG2  C  N N 284 
THR OXT  O  N N 285 
THR H    H  N N 286 
THR H2   H  N N 287 
THR HA   H  N N 288 
THR HB   H  N N 289 
THR HG1  H  N N 290 
THR HG21 H  N N 291 
THR HG22 H  N N 292 
THR HG23 H  N N 293 
THR HXT  H  N N 294 
TYR N    N  N N 295 
TYR CA   C  N S 296 
TYR C    C  N N 297 
TYR O    O  N N 298 
TYR CB   C  N N 299 
TYR CG   C  Y N 300 
TYR CD1  C  Y N 301 
TYR CD2  C  Y N 302 
TYR CE1  C  Y N 303 
TYR CE2  C  Y N 304 
TYR CZ   C  Y N 305 
TYR OH   O  N N 306 
TYR OXT  O  N N 307 
TYR H    H  N N 308 
TYR H2   H  N N 309 
TYR HA   H  N N 310 
TYR HB2  H  N N 311 
TYR HB3  H  N N 312 
TYR HD1  H  N N 313 
TYR HD2  H  N N 314 
TYR HE1  H  N N 315 
TYR HE2  H  N N 316 
TYR HH   H  N N 317 
TYR HXT  H  N N 318 
VAL N    N  N N 319 
VAL CA   C  N S 320 
VAL C    C  N N 321 
VAL O    O  N N 322 
VAL CB   C  N N 323 
VAL CG1  C  N N 324 
VAL CG2  C  N N 325 
VAL OXT  O  N N 326 
VAL H    H  N N 327 
VAL H2   H  N N 328 
VAL HA   H  N N 329 
VAL HB   H  N N 330 
VAL HG11 H  N N 331 
VAL HG12 H  N N 332 
VAL HG13 H  N N 333 
VAL HG21 H  N N 334 
VAL HG22 H  N N 335 
VAL HG23 H  N N 336 
VAL HXT  H  N N 337 
ZN  ZN   ZN N N 338 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PRO N   CA   sing N N 235 
PRO N   CD   sing N N 236 
PRO N   H    sing N N 237 
PRO CA  C    sing N N 238 
PRO CA  CB   sing N N 239 
PRO CA  HA   sing N N 240 
PRO C   O    doub N N 241 
PRO C   OXT  sing N N 242 
PRO CB  CG   sing N N 243 
PRO CB  HB2  sing N N 244 
PRO CB  HB3  sing N N 245 
PRO CG  CD   sing N N 246 
PRO CG  HG2  sing N N 247 
PRO CG  HG3  sing N N 248 
PRO CD  HD2  sing N N 249 
PRO CD  HD3  sing N N 250 
PRO OXT HXT  sing N N 251 
SER N   CA   sing N N 252 
SER N   H    sing N N 253 
SER N   H2   sing N N 254 
SER CA  C    sing N N 255 
SER CA  CB   sing N N 256 
SER CA  HA   sing N N 257 
SER C   O    doub N N 258 
SER C   OXT  sing N N 259 
SER CB  OG   sing N N 260 
SER CB  HB2  sing N N 261 
SER CB  HB3  sing N N 262 
SER OG  HG   sing N N 263 
SER OXT HXT  sing N N 264 
THR N   CA   sing N N 265 
THR N   H    sing N N 266 
THR N   H2   sing N N 267 
THR CA  C    sing N N 268 
THR CA  CB   sing N N 269 
THR CA  HA   sing N N 270 
THR C   O    doub N N 271 
THR C   OXT  sing N N 272 
THR CB  OG1  sing N N 273 
THR CB  CG2  sing N N 274 
THR CB  HB   sing N N 275 
THR OG1 HG1  sing N N 276 
THR CG2 HG21 sing N N 277 
THR CG2 HG22 sing N N 278 
THR CG2 HG23 sing N N 279 
THR OXT HXT  sing N N 280 
TYR N   CA   sing N N 281 
TYR N   H    sing N N 282 
TYR N   H2   sing N N 283 
TYR CA  C    sing N N 284 
TYR CA  CB   sing N N 285 
TYR CA  HA   sing N N 286 
TYR C   O    doub N N 287 
TYR C   OXT  sing N N 288 
TYR CB  CG   sing N N 289 
TYR CB  HB2  sing N N 290 
TYR CB  HB3  sing N N 291 
TYR CG  CD1  doub Y N 292 
TYR CG  CD2  sing Y N 293 
TYR CD1 CE1  sing Y N 294 
TYR CD1 HD1  sing N N 295 
TYR CD2 CE2  doub Y N 296 
TYR CD2 HD2  sing N N 297 
TYR CE1 CZ   doub Y N 298 
TYR CE1 HE1  sing N N 299 
TYR CE2 CZ   sing Y N 300 
TYR CE2 HE2  sing N N 301 
TYR CZ  OH   sing N N 302 
TYR OH  HH   sing N N 303 
TYR OXT HXT  sing N N 304 
VAL N   CA   sing N N 305 
VAL N   H    sing N N 306 
VAL N   H2   sing N N 307 
VAL CA  C    sing N N 308 
VAL CA  CB   sing N N 309 
VAL CA  HA   sing N N 310 
VAL C   O    doub N N 311 
VAL C   OXT  sing N N 312 
VAL CB  CG1  sing N N 313 
VAL CB  CG2  sing N N 314 
VAL CB  HB   sing N N 315 
VAL CG1 HG11 sing N N 316 
VAL CG1 HG12 sing N N 317 
VAL CG1 HG13 sing N N 318 
VAL CG2 HG21 sing N N 319 
VAL CG2 HG22 sing N N 320 
VAL CG2 HG23 sing N N 321 
VAL OXT HXT  sing N N 322 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Bruker AVANCE 1 'Bruker Avance' 
600 Varian INOVA  2 'Varian INOVA'  
# 
_atom_sites.entry_id                    2JRJ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_