data_2JSO # _entry.id 2JSO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2JSO RCSB RCSB100240 WWPDB D_1000100240 BMRB 15371 # _pdbx_database_related.db_id 15371 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JSO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-07-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jin, C.' 1 'Fu, W.' 2 # _citation.id primary _citation.title 'First structure of the polymyxin resistance proteins.' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 361 _citation.page_first 1033 _citation.page_last 1037 _citation.year 2007 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17686460 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2007.07.144 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fu, W.' 1 ? primary 'Yang, F.' 2 ? primary 'Kang, X.' 3 ? primary 'Zhang, X.' 4 ? primary 'Li, Y.' 5 ? primary 'Xia, B.' 6 ? primary 'Jin, C.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Polymyxin resistance protein pmrD' _entity.formula_weight 9885.536 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BasR/pmrA posttranscriptional activator, Signal transduction protein pmrD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQ CKVAGKTQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQ CKVAGKTQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 TRP n 1 4 LEU n 1 5 VAL n 1 6 LYS n 1 7 LYS n 1 8 SER n 1 9 CYS n 1 10 CYS n 1 11 ASN n 1 12 LYS n 1 13 GLN n 1 14 ASP n 1 15 ASN n 1 16 ARG n 1 17 HIS n 1 18 VAL n 1 19 LEU n 1 20 MET n 1 21 LEU n 1 22 CYS n 1 23 ASP n 1 24 ALA n 1 25 GLY n 1 26 GLY n 1 27 ALA n 1 28 ILE n 1 29 LYS n 1 30 MET n 1 31 ILE n 1 32 ALA n 1 33 GLU n 1 34 VAL n 1 35 LYS n 1 36 SER n 1 37 ASP n 1 38 PHE n 1 39 ALA n 1 40 VAL n 1 41 LYS n 1 42 VAL n 1 43 GLY n 1 44 ASP n 1 45 LEU n 1 46 LEU n 1 47 SER n 1 48 PRO n 1 49 LEU n 1 50 GLN n 1 51 ASN n 1 52 ALA n 1 53 LEU n 1 54 TYR n 1 55 CYS n 1 56 ILE n 1 57 ASN n 1 58 ARG n 1 59 GLU n 1 60 LYS n 1 61 LEU n 1 62 HIS n 1 63 THR n 1 64 VAL n 1 65 LYS n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 ALA n 1 70 SER n 1 71 SER n 1 72 TYR n 1 73 SER n 1 74 PRO n 1 75 ASP n 1 76 GLU n 1 77 TRP n 1 78 GLU n 1 79 ARG n 1 80 GLN n 1 81 CYS n 1 82 LYS n 1 83 VAL n 1 84 ALA n 1 85 GLY n 1 86 LYS n 1 87 THR n 1 88 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene pmrD _entity_src_gen.gene_src_species 'Escherichia coli' _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K12 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET21a(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PMRD_ECOLI _struct_ref.pdbx_db_accession P37590 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQ CKVAGKTQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JSO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P37590 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 88 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 2 '3D CBCA(CO)NH' 1 4 2 '3D HNCO' 1 5 2 '3D HNCA' 1 6 2 '3D HNCACB' 1 7 2 '3D HBHA(CO)NH' 1 8 2 '3D HN(CO)CA' 1 9 2 '3D HCCH-TOCSY' 1 10 2 '3D HNHA' 1 11 2 '3D 1H-15N NOESY' 1 12 2 '3D 1H-13C NOESY' 1 13 2 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 80 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 15N], antimicrobial resistance protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N], antimicrobial resistance protein, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2JSO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JSO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JSO _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 3 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Koll' refinement Amber 7.0 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JSO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JSO _struct.title 'Antimicrobial resistance protein' _struct.pdbx_descriptor 'Polymyxin resistance protein pmrD' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2JSO _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'protein, Antibiotic resistance, TRANSCRIPTION, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 73 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 84 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 73 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 84 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 45 ? LEU A 46 ? LEU A 45 LEU A 46 A 2 TRP A 3 ? CYS A 9 ? TRP A 3 CYS A 9 A 3 HIS A 17 ? ASP A 23 ? HIS A 17 ASP A 23 A 4 MET A 30 ? SER A 36 ? MET A 30 SER A 36 A 5 GLU A 59 ? SER A 71 ? GLU A 59 SER A 71 A 6 LEU A 53 ? ILE A 56 ? LEU A 53 ILE A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 46 ? O LEU A 46 N TRP A 3 ? N TRP A 3 A 2 3 N LEU A 4 ? N LEU A 4 O CYS A 22 ? O CYS A 22 A 3 4 N HIS A 17 ? N HIS A 17 O VAL A 34 ? O VAL A 34 A 4 5 N GLU A 33 ? N GLU A 33 O LEU A 67 ? O LEU A 67 A 5 6 N GLU A 59 ? N GLU A 59 O ILE A 56 ? O ILE A 56 # _atom_sites.entry_id 2JSO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLN 88 88 88 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'antimicrobial resistance protein' 1 mM '[U-100% 15N]' 1 'antimicrobial resistance protein' 1 mM '[U-100% 13C; U-100% 15N]' 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 11 HG A SER 70 ? ? OE2 A GLU 76 ? ? 1.58 2 13 OE2 A GLU 2 ? ? HG A SER 47 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.10 120.30 -3.20 0.50 N 2 4 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.28 120.30 -3.02 0.50 N 3 5 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 116.68 120.30 -3.62 0.50 N 4 6 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 116.62 120.30 -3.68 0.50 N 5 9 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH2 A ARG 79 ? ? 116.95 120.30 -3.35 0.50 N 6 12 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 116.66 120.30 -3.64 0.50 N 7 12 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH2 A ARG 79 ? ? 116.84 120.30 -3.46 0.50 N 8 13 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.13 120.30 -3.17 0.50 N 9 14 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH2 A ARG 79 ? ? 116.93 120.30 -3.37 0.50 N 10 16 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 116.49 120.30 -3.81 0.50 N 11 18 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 116.64 120.30 -3.66 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 14 ? ? -142.24 19.50 2 1 ASN A 15 ? ? 56.45 -21.65 3 1 ALA A 24 ? ? -68.12 67.49 4 1 ASN A 57 ? ? 68.68 -58.23 5 1 ARG A 58 ? ? 177.38 13.78 6 1 THR A 87 ? ? 57.22 79.97 7 2 ASN A 15 ? ? 55.18 3.41 8 2 ALA A 24 ? ? -66.47 73.45 9 2 ASN A 57 ? ? 68.38 -76.07 10 2 ARG A 58 ? ? -159.78 2.09 11 3 ASP A 14 ? ? -141.09 -5.66 12 3 ASN A 15 ? ? 69.93 -17.61 13 3 ALA A 24 ? ? -67.11 73.91 14 3 ASN A 57 ? ? 70.94 -63.56 15 3 ARG A 58 ? ? -170.50 -5.48 16 3 ALA A 84 ? ? -65.86 29.11 17 3 LYS A 86 ? ? -135.62 -115.16 18 4 LYS A 12 ? ? -141.85 -30.84 19 4 ASN A 15 ? ? 58.98 1.06 20 4 ALA A 24 ? ? -66.17 72.06 21 4 ASN A 57 ? ? 71.62 -43.54 22 4 ARG A 58 ? ? 152.48 -10.49 23 5 ASN A 11 ? ? -154.76 8.07 24 5 ASN A 15 ? ? 62.16 -6.41 25 5 ALA A 24 ? ? -66.71 71.71 26 5 ASN A 57 ? ? 71.16 -45.07 27 5 ARG A 58 ? ? 149.50 13.59 28 6 ASN A 15 ? ? 66.71 -22.04 29 6 ALA A 24 ? ? -65.47 72.89 30 6 ASN A 57 ? ? 67.94 -75.19 31 6 ARG A 58 ? ? -161.70 -3.08 32 7 ASN A 11 ? ? -135.42 -53.91 33 7 LYS A 12 ? ? 52.43 -30.69 34 7 ASN A 15 ? ? 72.19 -17.32 35 7 ALA A 24 ? ? -65.77 72.32 36 7 ASN A 57 ? ? 70.40 -65.28 37 7 ARG A 58 ? ? -172.44 -3.27 38 8 ASP A 14 ? ? -143.10 -14.41 39 8 ASN A 15 ? ? 68.90 -14.70 40 8 ALA A 24 ? ? -64.31 74.04 41 8 GLN A 50 ? ? -160.83 -167.30 42 8 ALA A 52 ? ? 60.14 -45.97 43 8 ASN A 57 ? ? 70.41 -66.53 44 8 ARG A 58 ? ? -172.43 -2.43 45 9 ASN A 15 ? ? 65.98 -9.00 46 9 ALA A 24 ? ? -66.02 72.70 47 9 GLN A 50 ? ? -160.37 -166.48 48 9 ALA A 52 ? ? 58.64 -44.95 49 9 ASN A 57 ? ? 71.01 -65.09 50 9 ARG A 58 ? ? -174.98 6.25 51 10 ASP A 14 ? ? -143.77 -0.98 52 10 ASN A 15 ? ? 70.07 -17.13 53 10 ALA A 24 ? ? -66.06 74.81 54 10 ASN A 57 ? ? 67.48 -74.50 55 10 ARG A 58 ? ? -161.90 -3.18 56 10 THR A 87 ? ? 39.00 49.19 57 11 ASN A 15 ? ? 42.31 24.52 58 11 ALA A 24 ? ? -66.95 73.81 59 11 ALA A 39 ? ? 49.90 -172.05 60 11 LYS A 41 ? ? -153.51 31.11 61 11 VAL A 42 ? ? 70.27 152.89 62 11 ASN A 57 ? ? 66.23 -74.33 63 11 ARG A 58 ? ? -162.21 11.49 64 11 LYS A 86 ? ? -156.71 18.98 65 12 ASN A 15 ? ? 57.86 -2.41 66 12 ALA A 24 ? ? -66.61 72.95 67 12 ASN A 57 ? ? 66.54 -66.39 68 12 ARG A 58 ? ? -170.64 6.54 69 13 LYS A 12 ? ? -140.00 -36.03 70 13 ASN A 15 ? ? 67.07 -22.56 71 13 ALA A 24 ? ? -66.59 73.74 72 13 ASN A 57 ? ? 71.87 -50.96 73 13 ARG A 58 ? ? 156.87 19.00 74 14 ASN A 15 ? ? 67.00 -6.86 75 14 ALA A 24 ? ? -66.72 72.53 76 14 ASN A 57 ? ? 70.76 -58.96 77 14 ARG A 58 ? ? -175.01 -10.28 78 14 LYS A 86 ? ? 49.61 29.51 79 15 ASN A 11 ? ? -132.22 -54.44 80 15 LYS A 12 ? ? 28.94 37.54 81 15 GLN A 13 ? ? -132.56 -30.81 82 15 ASN A 15 ? ? 70.13 -15.50 83 15 ALA A 24 ? ? -66.64 73.17 84 15 ASN A 57 ? ? 69.34 -61.99 85 15 ARG A 58 ? ? 174.04 21.44 86 16 ASP A 14 ? ? -151.47 14.07 87 16 ASN A 15 ? ? 59.91 -1.03 88 16 ARG A 16 ? ? -67.22 89.98 89 16 ALA A 24 ? ? -65.92 73.86 90 16 ALA A 27 ? ? -83.37 -70.65 91 16 ASN A 57 ? ? 71.74 -54.06 92 16 ARG A 58 ? ? 160.88 17.53 93 17 ASP A 14 ? ? -142.21 -1.65 94 17 ASN A 15 ? ? 70.19 -18.11 95 17 ALA A 24 ? ? -67.06 73.80 96 17 LYS A 41 ? ? -153.58 31.91 97 17 VAL A 42 ? ? 69.43 153.28 98 17 GLN A 50 ? ? -161.52 -168.62 99 17 ALA A 52 ? ? 57.19 -39.53 100 17 ASN A 57 ? ? 69.51 -63.95 101 17 ARG A 58 ? ? -174.12 3.44 102 18 ASN A 15 ? ? 66.12 -19.66 103 18 ALA A 24 ? ? -66.08 72.61 104 18 ASN A 57 ? ? 70.51 -44.79 105 18 ARG A 58 ? ? 150.44 13.56 106 19 ASN A 15 ? ? 68.81 -17.20 107 19 ALA A 24 ? ? -65.71 72.70 108 19 ASN A 57 ? ? 69.10 -66.87 109 19 ARG A 58 ? ? -171.06 0.56 110 20 ASN A 15 ? ? 62.26 -11.83 111 20 ALA A 24 ? ? -65.97 74.28 112 20 ASN A 57 ? ? 69.17 -66.27 113 20 ARG A 58 ? ? -173.27 -0.30 114 20 THR A 87 ? ? -68.53 55.25 115 21 ASN A 15 ? ? 66.54 -18.26 116 21 ALA A 24 ? ? -66.33 71.87 117 21 ASN A 57 ? ? 70.56 -40.62 118 21 ARG A 58 ? ? 136.68 12.90 119 21 GLU A 59 ? ? -73.86 -162.98 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LYS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 12 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLN _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 13 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -145.58 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 6 ARG A 16 ? ? 0.075 'SIDE CHAIN' 2 6 ARG A 79 ? ? 0.097 'SIDE CHAIN' 3 9 ARG A 16 ? ? 0.076 'SIDE CHAIN' 4 10 ARG A 79 ? ? 0.093 'SIDE CHAIN' 5 17 ARG A 79 ? ? 0.093 'SIDE CHAIN' #