data_2JT8 # _entry.id 2JT8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JT8 pdb_00002jt8 10.2210/pdb2jt8/pdb RCSB RCSB100260 ? ? WWPDB D_1000100260 ? ? BMRB 15400 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15400 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JT8 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-07-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, X.' 1 'Mercier, P.' 2 'Letourneau, P.' 3 'Sykes, B.D.' 4 # _citation.id primary _citation.title ;Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies ; _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 14 _citation.page_first 2447 _citation.page_last 2460 _citation.year 2005 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16131667 _citation.pdbx_database_id_DOI 10.1110/ps.051595805 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, X.' 1 ? primary 'Mercier, P.' 2 ? primary 'Letourneau, P.' 3 ? primary 'Sykes, B.' 4 ? # _cell.entry_id 2JT8 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JT8 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Troponin C, slow skeletal and cardiac muscles' _entity.formula_weight 18444.379 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'F153(FTR), C35S, C84S' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name TN-C # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDE(FTR)LEF MKGVE ; _entity_poly.pdbx_seq_one_letter_code_can ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEWLEFMKGV E ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASP n 1 4 ILE n 1 5 TYR n 1 6 LYS n 1 7 ALA n 1 8 ALA n 1 9 VAL n 1 10 GLU n 1 11 GLN n 1 12 LEU n 1 13 THR n 1 14 GLU n 1 15 GLU n 1 16 GLN n 1 17 LYS n 1 18 ASN n 1 19 GLU n 1 20 PHE n 1 21 LYS n 1 22 ALA n 1 23 ALA n 1 24 PHE n 1 25 ASP n 1 26 ILE n 1 27 PHE n 1 28 VAL n 1 29 LEU n 1 30 GLY n 1 31 ALA n 1 32 GLU n 1 33 ASP n 1 34 GLY n 1 35 SER n 1 36 ILE n 1 37 SER n 1 38 THR n 1 39 LYS n 1 40 GLU n 1 41 LEU n 1 42 GLY n 1 43 LYS n 1 44 VAL n 1 45 MET n 1 46 ARG n 1 47 MET n 1 48 LEU n 1 49 GLY n 1 50 GLN n 1 51 ASN n 1 52 PRO n 1 53 THR n 1 54 PRO n 1 55 GLU n 1 56 GLU n 1 57 LEU n 1 58 GLN n 1 59 GLU n 1 60 MET n 1 61 ILE n 1 62 ASP n 1 63 GLU n 1 64 VAL n 1 65 ASP n 1 66 GLU n 1 67 ASP n 1 68 GLY n 1 69 SER n 1 70 GLY n 1 71 THR n 1 72 VAL n 1 73 ASP n 1 74 PHE n 1 75 ASP n 1 76 GLU n 1 77 PHE n 1 78 LEU n 1 79 VAL n 1 80 MET n 1 81 MET n 1 82 VAL n 1 83 ARG n 1 84 SER n 1 85 MET n 1 86 LYS n 1 87 ASP n 1 88 ASP n 1 89 SER n 1 90 LYS n 1 91 GLY n 1 92 LYS n 1 93 SER n 1 94 GLU n 1 95 GLU n 1 96 GLU n 1 97 LEU n 1 98 SER n 1 99 ASP n 1 100 LEU n 1 101 PHE n 1 102 ARG n 1 103 MET n 1 104 PHE n 1 105 ASP n 1 106 LYS n 1 107 ASN n 1 108 ALA n 1 109 ASP n 1 110 GLY n 1 111 TYR n 1 112 ILE n 1 113 ASP n 1 114 LEU n 1 115 ASP n 1 116 GLU n 1 117 LEU n 1 118 LYS n 1 119 ILE n 1 120 MET n 1 121 LEU n 1 122 GLN n 1 123 ALA n 1 124 THR n 1 125 GLY n 1 126 GLU n 1 127 THR n 1 128 ILE n 1 129 THR n 1 130 GLU n 1 131 ASP n 1 132 ASP n 1 133 ILE n 1 134 GLU n 1 135 GLU n 1 136 LEU n 1 137 MET n 1 138 LYS n 1 139 ASP n 1 140 GLY n 1 141 ASP n 1 142 LYS n 1 143 ASN n 1 144 ASN n 1 145 ASP n 1 146 GLY n 1 147 ARG n 1 148 ILE n 1 149 ASP n 1 150 TYR n 1 151 ASP n 1 152 GLU n 1 153 FTR n 1 154 LEU n 1 155 GLU n 1 156 PHE n 1 157 MET n 1 158 LYS n 1 159 GLY n 1 160 VAL n 1 161 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'TNNC1, TNNC' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant '(DE3)pLysS' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNC1_HUMAN _struct_ref.pdbx_db_accession P63316 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV E ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JT8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P63316 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JT8 SER A 35 ? UNP P63316 CYS 35 'engineered mutation' 35 1 1 2JT8 SER A 84 ? UNP P63316 CYS 84 'engineered mutation' 84 2 1 2JT8 FTR A 153 ? UNP P63316 PHE 153 'engineered mutation' 153 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FTR 'L-peptide linking' n FLUOROTRYPTOPHANE ? 'C11 H11 F N2 O2' 222.216 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-13C NOESY' 1 4 1 '3D HNCACB' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.0 mM F153(FTR), 10 mM Calcium, 100 mM potassium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2JT8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JT8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JT8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JT8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JT8 _struct.title 'Solution structure of the F153-to-5-flurotryptophan mutant of human cardiac troponin C' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JT8 _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'EF-hand protein, Calcium-bind protein, Phe-to-Trp mutation, Acetylation, Muscle protein, Polymorphism, STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 4 ? LEU A 12 ? ILE A 4 LEU A 12 1 ? 9 HELX_P HELX_P2 2 GLU A 15 ? PHE A 20 ? GLU A 15 PHE A 20 1 ? 6 HELX_P HELX_P3 3 PHE A 20 ? VAL A 28 ? PHE A 20 VAL A 28 1 ? 9 HELX_P HELX_P4 4 GLU A 40 ? MET A 47 ? GLU A 40 MET A 47 1 ? 8 HELX_P HELX_P5 5 THR A 53 ? GLU A 63 ? THR A 53 GLU A 63 1 ? 11 HELX_P HELX_P6 6 ASP A 73 ? SER A 84 ? ASP A 73 SER A 84 1 ? 12 HELX_P HELX_P7 7 SER A 93 ? ASP A 105 ? SER A 93 ASP A 105 1 ? 13 HELX_P HELX_P8 8 ASP A 113 ? LYS A 118 ? ASP A 113 LYS A 118 1 ? 6 HELX_P HELX_P9 9 LYS A 118 ? ALA A 123 ? LYS A 118 ALA A 123 1 ? 6 HELX_P HELX_P10 10 ASP A 132 ? ASP A 141 ? ASP A 132 ASP A 141 1 ? 10 HELX_P HELX_P11 11 ASP A 151 ? MET A 157 ? ASP A 151 MET A 157 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLU 152 C ? ? ? 1_555 A FTR 153 N ? ? A GLU 152 A FTR 153 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A FTR 153 C ? ? ? 1_555 A LEU 154 N ? ? A FTR 153 A LEU 154 1_555 ? ? ? ? ? ? ? 1.327 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2JT8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 FTR 153 153 153 FTR FTR A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 GLU 161 161 161 GLU GLU A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id FTR _pdbx_struct_mod_residue.label_seq_id 153 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id FTR _pdbx_struct_mod_residue.auth_seq_id 153 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TRP _pdbx_struct_mod_residue.details FLUOROTRYPTOPHANE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-07 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 2 0 2020-02-19 4 'Structure model' 2 1 2021-10-20 5 'Structure model' 2 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' atom_site 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 4 'Structure model' database_2 8 4 'Structure model' struct_ref_seq_dif 9 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_atom_site.auth_atom_id' 2 3 'Structure model' '_atom_site.label_atom_id' 3 3 'Structure model' '_pdbx_database_status.status_code_cs' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_struct_ref_seq_dif.details' 8 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'F153(FTR)' 1.0 mM ? 1 Calcium 10 mM ? 1 'potassium chloride' 100 mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 64.65 155.82 2 1 ILE A 4 ? ? -164.54 -36.83 3 1 LYS A 39 ? ? -51.87 103.86 4 1 THR A 53 ? ? 178.88 -58.90 5 1 ASP A 65 ? ? -52.14 103.30 6 1 SER A 84 ? ? 56.66 84.83 7 1 LYS A 86 ? ? 69.21 -75.49 8 1 ASP A 88 ? ? 61.40 170.27 9 1 SER A 89 ? ? -179.36 -35.10 10 1 LYS A 90 ? ? -173.16 -170.30 11 1 LYS A 92 ? ? 63.02 165.32 12 1 ALA A 123 ? ? -116.68 75.06 13 1 THR A 124 ? ? -176.04 -37.47 14 1 LYS A 142 ? ? -162.31 -39.33 15 1 ASN A 144 ? ? 63.64 87.33 16 1 ASP A 145 ? ? -160.46 -40.20 17 1 ASP A 151 ? ? -179.56 -34.26 18 2 LYS A 39 ? ? -51.76 103.20 19 2 GLN A 50 ? ? -64.44 -177.13 20 2 THR A 53 ? ? 178.82 -58.93 21 2 SER A 84 ? ? 59.11 -170.27 22 2 LYS A 86 ? ? 61.10 179.85 23 2 SER A 89 ? ? -173.92 53.40 24 2 LYS A 90 ? ? 63.22 162.57 25 2 LYS A 92 ? ? -102.35 46.66 26 2 SER A 93 ? ? -113.83 -169.95 27 2 ALA A 123 ? ? -109.45 66.98 28 2 THR A 124 ? ? -165.88 28.80 29 2 GLU A 126 ? ? 52.12 87.45 30 2 ASP A 149 ? ? -106.43 -168.53 31 2 ASP A 151 ? ? -174.57 -36.40 32 2 MET A 157 ? ? -109.83 63.37 33 3 SER A 37 ? ? -151.53 -74.07 34 3 THR A 53 ? ? 178.91 -58.98 35 3 GLU A 63 ? ? -119.61 57.71 36 3 ASP A 65 ? ? -51.84 103.49 37 3 MET A 85 ? ? -109.74 56.43 38 3 LYS A 86 ? ? -179.48 -34.74 39 3 ASP A 88 ? ? -179.12 98.97 40 3 LYS A 92 ? ? -68.61 -173.58 41 3 GLU A 126 ? ? -57.81 -179.51 42 3 THR A 127 ? ? -105.27 67.72 43 3 ASP A 141 ? ? -53.76 173.62 44 3 LYS A 142 ? ? -158.61 -40.43 45 3 ASN A 143 ? ? -67.36 -79.68 46 3 ASN A 144 ? ? 176.03 -33.16 47 3 ASP A 149 ? ? -117.39 -166.71 48 3 LYS A 158 ? ? 63.25 105.08 49 4 ASP A 2 ? ? 63.71 159.17 50 4 LYS A 39 ? ? 65.95 -126.41 51 4 GLN A 50 ? ? -57.67 -179.14 52 4 THR A 53 ? ? 178.95 -58.78 53 4 VAL A 64 ? ? -130.83 -39.68 54 4 ASP A 65 ? ? -52.76 104.14 55 4 PHE A 74 ? ? -59.30 -70.35 56 4 SER A 84 ? ? -86.09 -74.40 57 4 ASP A 88 ? ? -167.35 117.67 58 4 SER A 89 ? ? -179.43 -34.98 59 4 LYS A 90 ? ? 63.15 166.11 60 4 GLU A 126 ? ? 50.97 -169.25 61 4 ASP A 151 ? ? -165.86 -41.88 62 5 ASP A 2 ? ? -114.81 54.18 63 5 ALA A 31 ? ? -60.11 -168.04 64 5 SER A 37 ? ? -46.08 159.83 65 5 LYS A 39 ? ? -50.61 101.59 66 5 THR A 53 ? ? 178.86 -58.88 67 5 ASP A 65 ? ? -102.06 78.33 68 5 SER A 69 ? ? -149.53 -42.04 69 5 SER A 84 ? ? 57.31 -175.55 70 5 MET A 85 ? ? -153.75 39.38 71 5 LYS A 90 ? ? 63.24 164.64 72 5 GLU A 126 ? ? -50.09 -75.43 73 5 THR A 127 ? ? 178.33 82.81 74 5 LYS A 142 ? ? -157.65 -39.86 75 5 ASN A 143 ? ? -64.77 -78.05 76 5 ASN A 144 ? ? 176.52 -32.80 77 5 ASP A 149 ? ? -101.34 -166.28 78 5 ASP A 151 ? ? -175.36 -36.07 79 6 ILE A 4 ? ? 78.02 -40.19 80 6 LYS A 39 ? ? -53.11 106.39 81 6 GLN A 50 ? ? 59.02 96.71 82 6 THR A 53 ? ? 178.91 -58.86 83 6 VAL A 64 ? ? -130.10 -40.17 84 6 SER A 84 ? ? 69.40 -75.64 85 6 MET A 85 ? ? 63.47 73.44 86 6 LYS A 86 ? ? -179.29 -34.79 87 6 ASP A 88 ? ? -143.56 -68.13 88 6 SER A 89 ? ? 63.20 163.18 89 6 SER A 93 ? ? -120.15 -169.84 90 6 THR A 124 ? ? -159.64 -40.94 91 6 THR A 127 ? ? -115.62 73.20 92 6 ASP A 151 ? ? 179.99 -34.04 93 7 ILE A 4 ? ? 46.42 26.62 94 7 SER A 35 ? ? -64.38 92.50 95 7 ILE A 36 ? ? -174.52 128.99 96 7 SER A 37 ? ? -177.97 -74.32 97 7 GLN A 50 ? ? 63.34 105.14 98 7 THR A 53 ? ? 178.94 -58.85 99 7 ASP A 65 ? ? -68.43 95.01 100 7 PHE A 74 ? ? -65.22 -74.05 101 7 LYS A 86 ? ? 37.66 43.80 102 7 GLU A 126 ? ? -61.58 -176.47 103 7 ASP A 141 ? ? -51.50 109.87 104 7 ASP A 151 ? ? 179.13 -33.43 105 7 LYS A 158 ? ? -53.58 -75.87 106 8 ASP A 2 ? ? -165.87 -50.09 107 8 SER A 37 ? ? -179.32 -60.92 108 8 GLN A 50 ? ? 62.25 101.89 109 8 THR A 53 ? ? 178.93 -58.86 110 8 ASP A 65 ? ? -52.07 105.49 111 8 MET A 85 ? ? 62.28 91.75 112 8 LYS A 86 ? ? -146.25 59.58 113 8 SER A 89 ? ? 69.12 -76.07 114 8 LYS A 90 ? ? 56.26 92.24 115 8 LYS A 92 ? ? -167.46 29.62 116 8 GLU A 126 ? ? -41.36 -76.69 117 8 THR A 127 ? ? -166.80 27.70 118 8 ASP A 141 ? ? -100.38 -161.86 119 8 ASN A 144 ? ? -178.94 26.77 120 8 ASP A 145 ? ? -142.64 -4.27 121 8 ASP A 151 ? ? -171.10 -37.72 122 9 ASP A 2 ? ? -172.80 -170.98 123 9 ILE A 4 ? ? 39.95 30.79 124 9 TYR A 5 ? ? -127.39 -69.53 125 9 SER A 37 ? ? -153.87 24.28 126 9 LYS A 39 ? ? 59.30 -116.99 127 9 GLU A 40 ? ? -95.92 -64.29 128 9 GLN A 50 ? ? -52.14 170.05 129 9 THR A 53 ? ? 178.85 -58.93 130 9 GLU A 63 ? ? -114.93 71.97 131 9 ASP A 65 ? ? -53.10 102.90 132 9 PHE A 74 ? ? -61.56 -73.56 133 9 MET A 85 ? ? -175.13 -35.91 134 9 ASP A 88 ? ? -179.18 -170.02 135 9 SER A 89 ? ? 63.19 163.75 136 9 LYS A 90 ? ? -173.86 142.88 137 9 LYS A 92 ? ? -179.29 63.70 138 9 ASP A 105 ? ? -68.24 87.19 139 9 ALA A 123 ? ? -58.47 -70.15 140 9 GLU A 126 ? ? -51.45 -75.95 141 9 THR A 127 ? ? -168.99 77.28 142 9 ASN A 144 ? ? 63.42 80.69 143 9 ASP A 145 ? ? -150.35 -40.78 144 10 ASP A 2 ? ? -179.18 -34.98 145 10 SER A 37 ? ? -158.60 26.28 146 10 LYS A 39 ? ? -173.33 64.42 147 10 THR A 53 ? ? 178.89 -58.89 148 10 ASP A 65 ? ? -52.66 102.85 149 10 MET A 85 ? ? -179.46 -34.35 150 10 LYS A 86 ? ? 58.04 178.84 151 10 THR A 124 ? ? -167.40 -65.75 152 10 GLU A 126 ? ? 71.62 -70.50 153 10 THR A 127 ? ? -167.51 28.07 154 10 ASN A 143 ? ? -67.28 -77.66 155 10 ASN A 144 ? ? 175.38 -36.68 156 10 ASP A 151 ? ? -175.99 -36.42 #