data_2JTV # _entry.id 2JTV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2JTV RCSB RCSB100283 WWPDB D_1000100283 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id RpT7 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JTV _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-08-07 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ignatchenko, A.' 1 'Gutmanas, A.' 2 'Lemak, A.' 3 'Yee, A.' 4 'Karra, M.' 5 'Srisailam, S.' 6 'Arrowsmith, C.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution Structure of protein RPA3401, Northeast Structural Genomics Consortium Target RpT7, Ontario Center for Structural Proteomics Target RP3384 ; 'TO BE PUBLISHED' ? ? ? ? ? ? ? 0353 ? ? ? 1 'A novel strategy for NMR resonance assignment and protein structure determination.' J.Biomol.Nmr 49 27 38 2011 JBNME9 NE 0925-2738 0800 ? 21161328 10.1007/s10858-010-9458-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ignatchenko, A.' 1 primary 'Gutmanas, A.' 2 primary 'Lemak, A.' 3 primary 'Yee, A.' 4 primary 'Karra, M.' 5 primary 'Srisailam, S.' 6 primary 'Arrowsmith, C.' 7 1 'Lemak, A.' 8 1 'Gutmanas, A.' 9 1 'Chitayat, S.' 10 1 'Karra, M.' 11 1 'Fares, C.' 12 1 'Sunnerhagen, M.' 13 1 'Arrowsmith, C.H.' 14 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein of Unknown Function' _entity.formula_weight 7379.232 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MATADDFKLIRDIHSTGGRRQVFGSREQKPFEDLVDLGWLKRSSVDSRATHYQITERGTSAALRS _entity_poly.pdbx_seq_one_letter_code_can MATADDFKLIRDIHSTGGRRQVFGSREQKPFEDLVDLGWLKRSSVDSRATHYQITERGTSAALRS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier RpT7 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 THR n 1 4 ALA n 1 5 ASP n 1 6 ASP n 1 7 PHE n 1 8 LYS n 1 9 LEU n 1 10 ILE n 1 11 ARG n 1 12 ASP n 1 13 ILE n 1 14 HIS n 1 15 SER n 1 16 THR n 1 17 GLY n 1 18 GLY n 1 19 ARG n 1 20 ARG n 1 21 GLN n 1 22 VAL n 1 23 PHE n 1 24 GLY n 1 25 SER n 1 26 ARG n 1 27 GLU n 1 28 GLN n 1 29 LYS n 1 30 PRO n 1 31 PHE n 1 32 GLU n 1 33 ASP n 1 34 LEU n 1 35 VAL n 1 36 ASP n 1 37 LEU n 1 38 GLY n 1 39 TRP n 1 40 LEU n 1 41 LYS n 1 42 ARG n 1 43 SER n 1 44 SER n 1 45 VAL n 1 46 ASP n 1 47 SER n 1 48 ARG n 1 49 ALA n 1 50 THR n 1 51 HIS n 1 52 TYR n 1 53 GLN n 1 54 ILE n 1 55 THR n 1 56 GLU n 1 57 ARG n 1 58 GLY n 1 59 THR n 1 60 SER n 1 61 ALA n 1 62 ALA n 1 63 LEU n 1 64 ARG n 1 65 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Rhodopseudomonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Rhodopseudomonas palustris' _entity_src_gen.gene_src_strain CGA009 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhodopseudomonas palustris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 258594 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'p15Tv lic' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6N4D8_RHOPA _struct_ref.pdbx_db_accession Q6N4D8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MATADDFKLIRDIHSTGGRRQVFGSREQKPFEDLVDLGWLKRSSVDSRATHYQITERGTSAALRS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JTV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6N4D8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 65 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY' 1 8 2 '3D HCCH-TOCSY' 1 9 2 '3D HCCH-TOCSY' 1 10 1 '4D(PR) HBHACBCA(CO)NH' 1 11 1 '4D(PR) HCC(CO)NH TOCSY' 1 12 2 '3D 1H-13C NOESY' 1 13 1 '3D 1H-13C aromatic NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.6 mM [U-13C; U-15N] RHA3401, 300 mM NaCl, 10 mM [U-99% 2H] TRIS, 1 mM Benzamidine, 0.01 % NaN3, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.6 mM [U-13C; U-15N] RHA3401, 300 mM NaCl, 10 mM [U-99% 2H] TRIS, 1 mM Benzamidine, 0.01 % NaN3, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker Avance 1 'Bruker Avance' 600 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2JTV _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JTV _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JTV _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, A.T. et al.' 'structure solution' CNS ? 1 'Brunger, A.T. et al.' refinement CNS ? 2 'Delaglio, F. et al.' processing NMRPipe ? 3 'Cornilescu, G. et al.' 'data analysis' TALOS ? 4 'Goddard, T.D. et al.' 'data analysis' SPARKY ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JTV _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JTV _struct.title ;Solution Structure of protein RPA3401, Northeast Structural Genomics Consortium Target RpT7, Ontario Center for Structural Proteomics Target RP3384 ; _struct.pdbx_descriptor 'Putative uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JTV _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS' _struct_keywords.text ;Protein with unknown function RPA3401, Northeast Structural Genomics Consortium, NESG, PSI-2, Structural Genomics, Protein Structure Initiative ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? THR A 16 ? THR A 3 THR A 16 1 ? 14 HELX_P HELX_P2 2 GLY A 24 ? LEU A 37 ? GLY A 24 LEU A 37 1 ? 14 HELX_P HELX_P3 3 THR A 55 ? ARG A 64 ? THR A 55 ARG A 64 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 19 ? VAL A 22 ? ARG A 19 VAL A 22 A 2 THR A 50 ? ILE A 54 ? THR A 50 ILE A 54 A 3 LEU A 40 ? VAL A 45 ? LEU A 40 VAL A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 20 ? N ARG A 20 O TYR A 52 ? O TYR A 52 A 2 3 O HIS A 51 ? O HIS A 51 N SER A 44 ? N SER A 44 # _atom_sites.entry_id 2JTV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 SER 65 65 65 SER SER A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-01-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id RHA3401 0.6 mM '[U-13C; U-15N]' 1 NaCl 300 mM ? 1 TRIS 10 mM '[U-99% 2H]' 1 Benzamidine 1 mM ? 1 NaN3 0.01 % ? 1 RHA3401 0.6 mM '[U-13C; U-15N]' 2 NaCl 300 mM ? 2 TRIS 10 mM '[U-99% 2H]' 2 Benzamidine 1 mM ? 2 NaN3 0.01 % ? 2 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 16 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 46 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HE2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HIS _pdbx_validate_close_contact.auth_seq_id_2 51 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 25 ? ? 61.64 -163.81 2 1 SER A 43 ? ? -90.68 -71.80 3 1 ARG A 48 ? ? -84.06 -73.56 4 1 THR A 55 ? ? -101.78 -169.58 5 2 SER A 44 ? ? 66.58 -76.81 6 2 VAL A 45 ? ? 62.47 104.66 7 2 SER A 47 ? ? 61.28 -93.44 8 3 SER A 47 ? ? -52.15 103.32 9 4 SER A 25 ? ? 50.26 -162.18 10 4 SER A 47 ? ? 39.01 76.15 11 4 ARG A 48 ? ? 62.29 -23.80 12 5 SER A 25 ? ? 70.92 -172.06 13 5 SER A 47 ? ? 58.38 -76.09 14 6 SER A 25 ? ? 59.20 -159.23 15 6 SER A 47 ? ? -49.47 106.39 16 6 ARG A 48 ? ? 67.57 -65.72 17 7 SER A 25 ? ? 173.17 177.93 18 7 SER A 44 ? ? -161.03 117.43 19 7 ARG A 48 ? ? -121.79 -52.20 20 8 SER A 47 ? ? 62.02 -142.45 21 9 ARG A 48 ? ? 64.60 -12.84 22 10 SER A 43 ? ? -144.73 -61.38 23 10 SER A 47 ? ? 65.24 -80.04 24 10 ARG A 48 ? ? -151.75 10.06 25 11 SER A 25 ? ? 61.92 -177.76 26 11 SER A 47 ? ? 71.63 -56.03 27 11 ARG A 48 ? ? -176.12 -16.81 28 12 SER A 47 ? ? 67.00 -75.20 29 12 ARG A 64 ? ? 60.70 103.15 30 13 SER A 25 ? ? -156.89 -37.91 31 13 SER A 44 ? ? 52.74 72.03 32 13 SER A 47 ? ? 48.79 -92.41 33 14 SER A 47 ? ? 54.73 71.40 34 14 ARG A 48 ? ? 64.33 -31.31 35 15 SER A 25 ? ? 58.99 -171.81 36 15 SER A 47 ? ? 64.65 -81.96 37 16 SER A 25 ? ? 65.35 -157.35 38 16 SER A 43 ? ? -157.56 -58.19 39 16 ARG A 48 ? ? 75.78 -37.76 40 18 PHE A 23 ? ? -64.77 -72.82 41 18 SER A 43 ? ? -103.68 -73.77 42 19 SER A 25 ? ? 67.99 -157.41 43 19 SER A 43 ? ? -87.56 -70.51 44 19 VAL A 45 ? ? 53.00 83.54 45 20 SER A 25 ? ? 62.85 -163.38 #