data_2JTZ # _entry.id 2JTZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JTZ pdb_00002jtz 10.2210/pdb2jtz/pdb RCSB RCSB100287 ? ? WWPDB D_1000100287 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JTZ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-08-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, X.' 1 'Mercier, P.' 2 'Letourneau, P.' 3 'Sykes, B.D.' 4 # _citation.id primary _citation.title ;Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies ; _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 14 _citation.page_first 2447 _citation.page_last 2460 _citation.year 2005 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16131667 _citation.pdbx_database_id_DOI 10.1110/ps.051595805 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, X.' 1 ? primary 'Mercier, P.' 2 ? primary 'Letourneau, P.' 3 ? primary 'Sykes, B.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Troponin C, slow skeletal and cardiac muscles' _entity.formula_weight 18444.377 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'F104(FTR), C35S, C84S' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name TN-C # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRSMKDDSKGKSEEELSDLFRM(FTR)DKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEF MKGVE ; _entity_poly.pdbx_seq_one_letter_code_can ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRSMKDDSKGKSEEELSDLFRMWDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV E ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASP n 1 4 ILE n 1 5 TYR n 1 6 LYS n 1 7 ALA n 1 8 ALA n 1 9 VAL n 1 10 GLU n 1 11 GLN n 1 12 LEU n 1 13 THR n 1 14 GLU n 1 15 GLU n 1 16 GLN n 1 17 LYS n 1 18 ASN n 1 19 GLU n 1 20 PHE n 1 21 LYS n 1 22 ALA n 1 23 ALA n 1 24 PHE n 1 25 ASP n 1 26 ILE n 1 27 PHE n 1 28 VAL n 1 29 LEU n 1 30 GLY n 1 31 ALA n 1 32 GLU n 1 33 ASP n 1 34 GLY n 1 35 SER n 1 36 ILE n 1 37 SER n 1 38 THR n 1 39 LYS n 1 40 GLU n 1 41 LEU n 1 42 GLY n 1 43 LYS n 1 44 VAL n 1 45 MET n 1 46 ARG n 1 47 MET n 1 48 LEU n 1 49 GLY n 1 50 GLN n 1 51 ASN n 1 52 PRO n 1 53 THR n 1 54 PRO n 1 55 GLU n 1 56 GLU n 1 57 LEU n 1 58 GLN n 1 59 GLU n 1 60 MET n 1 61 ILE n 1 62 ASP n 1 63 GLU n 1 64 VAL n 1 65 ASP n 1 66 GLU n 1 67 ASP n 1 68 GLY n 1 69 SER n 1 70 GLY n 1 71 THR n 1 72 VAL n 1 73 ASP n 1 74 PHE n 1 75 ASP n 1 76 GLU n 1 77 PHE n 1 78 LEU n 1 79 VAL n 1 80 MET n 1 81 MET n 1 82 VAL n 1 83 ARG n 1 84 SER n 1 85 MET n 1 86 LYS n 1 87 ASP n 1 88 ASP n 1 89 SER n 1 90 LYS n 1 91 GLY n 1 92 LYS n 1 93 SER n 1 94 GLU n 1 95 GLU n 1 96 GLU n 1 97 LEU n 1 98 SER n 1 99 ASP n 1 100 LEU n 1 101 PHE n 1 102 ARG n 1 103 MET n 1 104 FTR n 1 105 ASP n 1 106 LYS n 1 107 ASN n 1 108 ALA n 1 109 ASP n 1 110 GLY n 1 111 TYR n 1 112 ILE n 1 113 ASP n 1 114 LEU n 1 115 ASP n 1 116 GLU n 1 117 LEU n 1 118 LYS n 1 119 ILE n 1 120 MET n 1 121 LEU n 1 122 GLN n 1 123 ALA n 1 124 THR n 1 125 GLY n 1 126 GLU n 1 127 THR n 1 128 ILE n 1 129 THR n 1 130 GLU n 1 131 ASP n 1 132 ASP n 1 133 ILE n 1 134 GLU n 1 135 GLU n 1 136 LEU n 1 137 MET n 1 138 LYS n 1 139 ASP n 1 140 GLY n 1 141 ASP n 1 142 LYS n 1 143 ASN n 1 144 ASN n 1 145 ASP n 1 146 GLY n 1 147 ARG n 1 148 ILE n 1 149 ASP n 1 150 TYR n 1 151 ASP n 1 152 GLU n 1 153 PHE n 1 154 LEU n 1 155 GLU n 1 156 PHE n 1 157 MET n 1 158 LYS n 1 159 GLY n 1 160 VAL n 1 161 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'TNNC1, TNNC' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNC1_HUMAN _struct_ref.pdbx_db_accession P63316 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV E ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JTZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P63316 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JTZ SER A 35 ? UNP P63316 CYS 35 'engineered mutation' 35 1 1 2JTZ SER A 84 ? UNP P63316 CYS 84 'engineered mutation' 84 2 1 2JTZ FTR A 104 ? UNP P63316 PHE 104 'engineered mutation' 104 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FTR 'L-peptide linking' n FLUOROTRYPTOPHANE ? 'C11 H11 F N2 O2' 222.216 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-13C NOESY' 1 4 1 '3D HNCACB' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.0 mM [U-100% 13C; U-100% 15N] F104(FTR), 10 mM Calcium, 100 mM potassium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2JTZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JTZ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JTZ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JTZ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JTZ _struct.title 'Solution structure and chemical shift assignments of the F104-to-5-flurotryptophan mutant of cardiac troponin C' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JTZ _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text 'EF-hand protein, Calcium-binding protein, Phe-to-Trp mutation, Acetylation, Muscle protein, Polymorphism, CONTRACTILE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 3 ? GLN A 11 ? ASP A 3 GLN A 11 1 ? 9 HELX_P HELX_P2 2 GLU A 15 ? ILE A 26 ? GLU A 15 ILE A 26 1 ? 12 HELX_P HELX_P3 3 SER A 37 ? LEU A 41 ? SER A 37 LEU A 41 5 ? 5 HELX_P HELX_P4 4 GLY A 42 ? LEU A 48 ? GLY A 42 LEU A 48 1 ? 7 HELX_P HELX_P5 5 PRO A 54 ? GLU A 63 ? PRO A 54 GLU A 63 1 ? 10 HELX_P HELX_P6 6 ASP A 75 ? MET A 80 ? ASP A 75 MET A 80 1 ? 6 HELX_P HELX_P7 7 GLU A 94 ? ASP A 105 ? GLU A 94 ASP A 105 1 ? 12 HELX_P HELX_P8 8 ASP A 113 ? ALA A 123 ? ASP A 113 ALA A 123 1 ? 11 HELX_P HELX_P9 9 THR A 129 ? GLU A 134 ? THR A 129 GLU A 134 1 ? 6 HELX_P HELX_P10 10 GLU A 134 ? GLY A 140 ? GLU A 134 GLY A 140 1 ? 7 HELX_P HELX_P11 11 ASP A 149 ? GLU A 155 ? ASP A 149 GLU A 155 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MET 103 C ? ? ? 1_555 A FTR 104 N ? ? A MET 103 A FTR 104 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A FTR 104 C ? ? ? 1_555 A ASP 105 N ? ? A FTR 104 A ASP 105 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2JTZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F H N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 FTR 104 104 104 FTR FTR A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 GLU 161 161 161 GLU GLU A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id FTR _pdbx_struct_mod_residue.label_seq_id 104 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id FTR _pdbx_struct_mod_residue.auth_seq_id 104 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TRP _pdbx_struct_mod_residue.details FLUOROTRYPTOPHANE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-28 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_conn 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'F104(FTR)' 1.0 mM '[U-100% 13C; U-100% 15N]' 1 Calcium 10 mM ? 1 'potassium chloride' 100 mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -160.46 108.11 2 1 ASP A 3 ? ? 66.55 123.83 3 1 ALA A 31 ? ? -54.36 174.17 4 1 MET A 47 ? ? -124.78 -56.86 5 1 GLU A 63 ? ? 179.53 108.79 6 1 ASP A 73 ? ? -66.19 -176.97 7 1 MET A 85 ? ? -60.16 -172.66 8 1 LYS A 86 ? ? -66.46 89.41 9 1 ASP A 88 ? ? -110.87 66.91 10 1 SER A 89 ? ? -159.42 47.70 11 1 FTR A 104 ? ? -89.46 -81.29 12 1 ASP A 105 ? ? 41.76 92.80 13 1 ASP A 141 ? ? -179.50 96.44 14 1 PHE A 156 ? ? -35.45 -82.69 15 1 MET A 157 ? ? 179.21 27.61 16 2 SER A 35 ? ? -59.27 -175.47 17 2 MET A 47 ? ? -68.07 -74.74 18 2 GLU A 63 ? ? -177.36 104.76 19 2 ASP A 73 ? ? -104.32 -169.50 20 2 SER A 84 ? ? 63.37 105.47 21 2 SER A 89 ? ? -179.31 107.37 22 2 FTR A 104 ? ? -75.74 -82.88 23 2 ASP A 105 ? ? 42.85 92.83 24 2 ASP A 141 ? ? -68.93 65.32 25 2 ASN A 144 ? ? 50.28 85.17 26 2 ASP A 145 ? ? -135.25 -35.57 27 2 PHE A 156 ? ? -41.38 -84.64 28 2 MET A 157 ? ? -156.01 44.20 29 2 LYS A 158 ? ? 36.46 66.33 30 2 VAL A 160 ? ? -49.61 97.24 31 3 LEU A 12 ? ? 64.09 157.61 32 3 GLU A 63 ? ? -177.64 88.35 33 3 MET A 85 ? ? 68.72 -76.00 34 3 FTR A 104 ? ? -94.59 -83.17 35 3 ASP A 105 ? ? 38.09 90.65 36 3 ALA A 123 ? ? -91.78 42.38 37 3 THR A 124 ? ? 177.05 -32.67 38 3 ASP A 141 ? ? 37.58 51.23 39 3 ASN A 144 ? ? 58.27 81.77 40 3 ASP A 145 ? ? -173.36 20.04 41 3 PHE A 156 ? ? -41.25 -84.54 42 3 MET A 157 ? ? -161.45 24.63 43 3 LYS A 158 ? ? 73.01 -58.40 44 3 VAL A 160 ? ? -49.69 91.68 45 4 ASP A 2 ? ? 61.51 100.20 46 4 ASP A 3 ? ? -167.74 -82.85 47 4 GLU A 63 ? ? -178.11 107.50 48 4 SER A 84 ? ? -52.57 170.78 49 4 ASP A 88 ? ? -111.44 -169.58 50 4 FTR A 104 ? ? -101.72 -81.78 51 4 ASP A 105 ? ? 34.17 89.77 52 4 ALA A 123 ? ? -95.93 36.71 53 4 THR A 124 ? ? -177.68 -37.46 54 4 THR A 127 ? ? -55.78 99.24 55 4 ASP A 141 ? ? -178.85 96.48 56 4 PHE A 156 ? ? -57.15 -99.44 57 4 MET A 157 ? ? 178.17 33.40 58 4 VAL A 160 ? ? -66.77 82.51 59 5 ASP A 2 ? ? 69.40 -76.03 60 5 ASP A 3 ? ? -171.48 145.66 61 5 LEU A 12 ? ? 52.33 77.22 62 5 ALA A 31 ? ? -54.44 104.59 63 5 GLU A 63 ? ? -179.24 96.39 64 5 SER A 84 ? ? 62.98 -169.90 65 5 ASP A 88 ? ? -179.09 140.70 66 5 SER A 89 ? ? 63.26 105.80 67 5 FTR A 104 ? ? -64.78 -83.26 68 5 ASP A 105 ? ? 41.50 90.50 69 5 ASP A 141 ? ? 21.70 68.73 70 5 PHE A 156 ? ? -33.44 -82.96 71 5 MET A 157 ? ? -151.78 18.60 72 5 LYS A 158 ? ? 73.95 -58.07 73 6 GLU A 63 ? ? -178.75 99.86 74 6 ASP A 73 ? ? -60.54 -168.69 75 6 MET A 85 ? ? -58.70 -178.57 76 6 ASP A 88 ? ? -114.87 -74.87 77 6 FTR A 104 ? ? -71.54 -83.71 78 6 ASP A 105 ? ? 36.86 95.12 79 6 THR A 124 ? ? -166.30 -77.96 80 6 THR A 127 ? ? -49.86 97.21 81 6 ASN A 144 ? ? 51.20 83.61 82 6 ASP A 145 ? ? -130.01 -35.55 83 7 ALA A 31 ? ? -55.48 174.63 84 7 SER A 35 ? ? -123.51 -169.44 85 7 PRO A 52 ? ? -69.80 -178.86 86 7 GLU A 63 ? ? -160.68 98.39 87 7 SER A 84 ? ? -110.90 79.95 88 7 MET A 85 ? ? 62.91 163.16 89 7 SER A 89 ? ? -178.38 127.69 90 7 FTR A 104 ? ? -90.76 -81.25 91 7 ASP A 105 ? ? 47.22 96.55 92 7 THR A 124 ? ? 178.55 108.29 93 7 ASP A 141 ? ? -179.31 74.88 94 7 ASN A 144 ? ? 54.50 79.92 95 7 ASP A 145 ? ? -145.45 14.45 96 8 ASP A 3 ? ? 66.08 121.24 97 8 SER A 35 ? ? -179.26 -74.15 98 8 MET A 47 ? ? -67.94 -74.76 99 8 GLU A 63 ? ? -179.25 92.31 100 8 ASP A 73 ? ? -79.54 -168.68 101 8 SER A 84 ? ? 62.58 93.07 102 8 ASP A 88 ? ? -104.12 -68.05 103 8 FTR A 104 ? ? -68.57 -82.83 104 8 ASP A 105 ? ? 40.02 94.30 105 8 THR A 127 ? ? -57.10 99.01 106 8 ASP A 141 ? ? 178.03 96.89 107 8 MET A 157 ? ? -50.20 -74.94 108 8 LYS A 158 ? ? 37.23 47.26 109 9 ASP A 2 ? ? -102.26 -73.37 110 9 ASP A 3 ? ? -177.69 -84.74 111 9 LEU A 12 ? ? 58.42 177.66 112 9 SER A 35 ? ? 51.09 -169.76 113 9 PRO A 52 ? ? -69.71 -170.40 114 9 GLU A 63 ? ? -178.05 107.88 115 9 SER A 84 ? ? 179.47 137.23 116 9 ASP A 88 ? ? -155.08 -75.12 117 9 SER A 89 ? ? -179.57 -178.32 118 9 ASP A 105 ? ? -102.32 73.14 119 9 ALA A 123 ? ? -96.13 50.53 120 9 ASP A 141 ? ? 33.44 48.98 121 9 ASN A 144 ? ? 58.27 77.58 122 9 ASP A 145 ? ? -166.36 18.58 123 9 PHE A 156 ? ? -45.75 -86.69 124 9 MET A 157 ? ? -154.00 42.57 125 9 LYS A 158 ? ? 38.72 42.79 126 9 VAL A 160 ? ? -49.14 98.89 127 10 ASP A 2 ? ? -70.53 -73.92 128 10 LEU A 12 ? ? 58.73 94.04 129 10 ALA A 31 ? ? -63.82 92.53 130 10 PRO A 52 ? ? -69.81 -170.49 131 10 GLU A 63 ? ? -168.74 103.19 132 10 ASP A 73 ? ? -61.33 -169.04 133 10 SER A 84 ? ? -60.09 -174.99 134 10 MET A 85 ? ? 69.14 -75.68 135 10 FTR A 104 ? ? -107.06 -81.95 136 10 ASP A 105 ? ? 41.52 93.22 137 10 ASP A 113 ? ? -102.70 -169.00 138 10 THR A 127 ? ? -58.87 97.87 139 10 ASP A 141 ? ? 51.99 86.22 140 10 ASP A 149 ? ? -103.98 -169.64 #