data_2JU2 # _entry.id 2JU2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JU2 pdb_00002ju2 10.2210/pdb2ju2/pdb RCSB RCSB100290 ? ? WWPDB D_1000100290 ? ? # _pdbx_database_related.db_id 2ju1 _pdbx_database_related.db_name PDB _pdbx_database_related.details 'ensemble of 30 structures of the acyl carrier protein domain from module 2 of the 6-deoxyerythronolide B synthase (DEBS)' _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JU2 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-08-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Alekseyev, V.Y.' 1 'Liu, C.W.' 2 'Puglisi, J.D.' 3 'Khosla, C.' 4 # _citation.id primary _citation.title ;Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase. ; _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 16 _citation.page_first 2093 _citation.page_last 2107 _citation.year 2007 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17893358 _citation.pdbx_database_id_DOI 10.1110/ps.073011407 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Alekseyev, V.Y.' 1 ? primary 'Liu, C.W.' 2 ? primary 'Cane, D.E.' 3 ? primary 'Puglisi, J.D.' 4 ? primary 'Khosla, C.' 5 ? # _cell.entry_id 2JU2 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JU2 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Erythronolide synthase' _entity.formula_weight 10160.617 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.94 _entity.pdbx_mutation ? _entity.pdbx_fragment 'acyl carrier protein domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ORF 1, 6-deoxyerythronolide B synthase I, DEBS 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDH PNASAVAGFLDAELG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDH PNASAVAGFLDAELG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 LEU n 1 6 ARG n 1 7 ASP n 1 8 ARG n 1 9 LEU n 1 10 ALA n 1 11 GLY n 1 12 LEU n 1 13 PRO n 1 14 ARG n 1 15 ALA n 1 16 GLU n 1 17 ARG n 1 18 THR n 1 19 ALA n 1 20 GLU n 1 21 LEU n 1 22 VAL n 1 23 ARG n 1 24 LEU n 1 25 VAL n 1 26 ARG n 1 27 THR n 1 28 SER n 1 29 THR n 1 30 ALA n 1 31 THR n 1 32 VAL n 1 33 LEU n 1 34 GLY n 1 35 HIS n 1 36 ASP n 1 37 ASP n 1 38 PRO n 1 39 LYS n 1 40 ALA n 1 41 VAL n 1 42 ARG n 1 43 ALA n 1 44 THR n 1 45 THR n 1 46 PRO n 1 47 PHE n 1 48 LYS n 1 49 GLU n 1 50 LEU n 1 51 GLY n 1 52 PHE n 1 53 ASP n 1 54 SER n 1 55 LEU n 1 56 ALA n 1 57 ALA n 1 58 VAL n 1 59 ARG n 1 60 LEU n 1 61 ARG n 1 62 ASN n 1 63 LEU n 1 64 LEU n 1 65 ASN n 1 66 ALA n 1 67 ALA n 1 68 THR n 1 69 GLY n 1 70 LEU n 1 71 ARG n 1 72 LEU n 1 73 PRO n 1 74 SER n 1 75 THR n 1 76 LEU n 1 77 VAL n 1 78 PHE n 1 79 ASP n 1 80 HIS n 1 81 PRO n 1 82 ASN n 1 83 ALA n 1 84 SER n 1 85 ALA n 1 86 VAL n 1 87 ALA n 1 88 GLY n 1 89 PHE n 1 90 LEU n 1 91 ASP n 1 92 ALA n 1 93 GLU n 1 94 LEU n 1 95 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Saccharopolyspora _entity_src_gen.pdbx_gene_src_gene eryA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharopolyspora erythraea' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1836 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET28(a)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'stop codon at the C-terminus, before the C-terminal His-tag present in the expression vector plasmid' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ERYA1_SACER _struct_ref.pdbx_db_accession Q03131 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNAS AVAGFLDAELG ; _struct_ref.pdbx_align_begin 3318 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JU2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q03131 _struct_ref_seq.db_align_beg 3318 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 3408 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JU2 GLY A 1 ? UNP Q03131 ? ? 'expression tag' 1 1 1 2JU2 SER A 2 ? UNP Q03131 ? ? 'expression tag' 2 2 1 2JU2 HIS A 3 ? UNP Q03131 ? ? 'expression tag' 3 3 1 2JU2 MET A 4 ? UNP Q03131 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C/15N NOESY' 1 3 1 '3D HCCH-TOCSY' 1 4 1 '3D HNHA' 1 5 1 '2D 1H-15N HSQC' 1 6 1 '3D HNCACB' 1 7 1 '3D C(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 30 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.8-1 mM [U-13C; U-15N] acyl carrier protein, 0.05 % sodium azide, 30 mM sodium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 500 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2JU2 _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ;The standard simulated annealing protocol included as part of DYANA software was used to calculate a total of 50 structures, of which 30 structures with the lowest target function values were chosen for the solution structure ensemble. The helical regions of these 30 structures were superimposed and the mean structure was obtained using MOLMOL software, then subjected to the standard variable target function minimization implemented in DYANA. The resulting minimized mean structure is deposited here. The ensemble of 30 structures is deposited in the PDB entry 2ju1. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JU2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JU2 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, P. et al.' 'structure solution' DYANA 1.5 1 'Guntert, P. et al.' refinement DYANA 1.5 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'residues 5-95 are identical to the DEBS residues 3318-3408 (EryA, EntrezProtein accession no. AAA26493)' _exptl.entry_id 2JU2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JU2 _struct.title 'Minimized mean solution structure of the acyl carrier protein domain from module 2 of 6-deoxyerythronolide B synthase (DEBS)' _struct.pdbx_model_details 'residues 5-95 are identical to the DEBS residues 3318-3408 (EryA, EntrezProtein accession no. AAA26493)' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2JU2 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;carrier protein domain, modular polyketide synthase, alpha-helical bundle, Acyltransferase, Antibiotic biosynthesis, Multifunctional enzyme, NADP, Phosphopantetheine, Transferase ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 4 ? ALA A 10 ? MET A 4 ALA A 10 1 ? 7 HELX_P HELX_P2 2 PRO A 13 ? GLY A 34 ? PRO A 13 GLY A 34 1 ? 22 HELX_P HELX_P3 3 ASP A 37 ? VAL A 41 ? ASP A 37 VAL A 41 5 ? 5 HELX_P HELX_P4 4 PRO A 46 ? PHE A 52 ? PRO A 46 PHE A 52 1 ? 7 HELX_P HELX_P5 5 SER A 54 ? GLY A 69 ? SER A 54 GLY A 69 1 ? 16 HELX_P HELX_P6 6 THR A 75 ? HIS A 80 ? THR A 75 HIS A 80 1 ? 6 HELX_P HELX_P7 7 ASN A 82 ? GLY A 95 ? ASN A 82 GLY A 95 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2JU2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLY 95 95 95 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'acyl carrier protein' 0.8 mM '[U-13C; U-15N]' 1 'sodium azide' 0.05 % ? 1 'sodium phosphate' 30 mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 60 ? ? H A LEU 64 ? ? 1.52 2 1 O A ARG 14 ? ? H A THR 18 ? ? 1.53 3 1 O A LEU 24 ? ? H A SER 28 ? ? 1.53 4 1 O A THR 27 ? ? H A THR 31 ? ? 1.53 5 1 O A THR 75 ? ? H A ASP 79 ? ? 1.54 6 1 O A ALA 43 ? ? H A SER 84 ? ? 1.56 7 1 O A LEU 76 ? ? H A HIS 80 ? ? 1.56 8 1 O A GLY 88 ? ? H A ALA 92 ? ? 1.57 9 1 O A LEU 5 ? ? H A LEU 9 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 3 ? ? 71.74 -65.32 2 1 MET A 4 ? ? -88.41 38.75 3 1 ALA A 10 ? ? -85.40 34.68 4 1 LEU A 12 ? ? 30.60 86.21 5 1 ALA A 15 ? ? -42.35 -70.26 6 1 ASP A 36 ? ? -114.92 55.10 7 1 ALA A 40 ? ? -93.13 41.13 8 1 ASP A 53 ? ? -137.64 -60.86 9 1 SER A 54 ? ? -144.72 -61.48 10 1 LEU A 60 ? ? -55.26 -76.25 11 1 THR A 68 ? ? -112.55 -73.31 12 1 LEU A 72 ? ? -44.83 160.59 13 1 SER A 84 ? ? -36.64 -39.69 #