data_2JVE # _entry.id 2JVE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JVE pdb_00002jve 10.2210/pdb2jve/pdb RCSB RCSB100338 ? ? BMRB 15477 ? 10.13018/BMR15477 WWPDB D_1000100338 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-30 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-12-19 4 'Structure model' 1 3 2020-02-19 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Source and taxonomy' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Database references' 11 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' struct_ref_seq_dif 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_database_status 6 6 'Structure model' chem_comp_atom 7 6 'Structure model' chem_comp_bond 8 6 'Structure model' database_2 9 6 'Structure model' pdbx_entry_details 10 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JVE _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-09-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 15477 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Garza-Garcia, A.' 1 'Harris, R.' 2 'Esposito, D.' 3 'Driscoll, P.C.' 4 # _citation.id primary _citation.title ;Solution structure and phylogenetics of Prod1, a member of the three-finger protein superfamily implicated in salamander limb regeneration. ; _citation.journal_abbrev 'Plos One' _citation.journal_volume 4 _citation.page_first e7123 _citation.page_last e7123 _citation.year 2009 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19771161 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0007123 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Garza-Garcia, A.' 1 ? primary 'Harris, R.' 2 ? primary 'Esposito, D.' 3 ? primary 'Gates, P.B.' 4 ? primary 'Driscoll, P.C.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Prod 1' _entity.formula_weight 10223.500 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKC CCEDLCNRSEQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKC CCEDLCNRSEQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 LEU n 1 24 LYS n 1 25 CYS n 1 26 PHE n 1 27 THR n 1 28 ARG n 1 29 ASN n 1 30 GLY n 1 31 ASP n 1 32 ASP n 1 33 ARG n 1 34 THR n 1 35 VAL n 1 36 THR n 1 37 THR n 1 38 CYS n 1 39 ALA n 1 40 GLU n 1 41 GLU n 1 42 GLN n 1 43 THR n 1 44 ARG n 1 45 CYS n 1 46 LEU n 1 47 PHE n 1 48 VAL n 1 49 GLN n 1 50 LEU n 1 51 PRO n 1 52 TYR n 1 53 SER n 1 54 GLU n 1 55 ILE n 1 56 GLN n 1 57 GLU n 1 58 CYS n 1 59 LYS n 1 60 THR n 1 61 VAL n 1 62 GLN n 1 63 GLN n 1 64 CYS n 1 65 ALA n 1 66 GLU n 1 67 VAL n 1 68 LEU n 1 69 GLU n 1 70 GLU n 1 71 VAL n 1 72 THR n 1 73 ALA n 1 74 ILE n 1 75 GLY n 1 76 TYR n 1 77 PRO n 1 78 ALA n 1 79 LYS n 1 80 CYS n 1 81 CYS n 1 82 CYS n 1 83 GLU n 1 84 ASP n 1 85 LEU n 1 86 CYS n 1 87 ASN n 1 88 ARG n 1 89 SER n 1 90 GLU n 1 91 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'red-spotted newt' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Notophthalmus viridescens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8316 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 SER 3 0 ? ? ? A . n A 1 4 SER 4 1 ? ? ? A . n A 1 5 HIS 5 2 ? ? ? A . n A 1 6 HIS 6 3 ? ? ? A . n A 1 7 HIS 7 4 ? ? ? A . n A 1 8 HIS 8 5 ? ? ? A . n A 1 9 HIS 9 6 ? ? ? A . n A 1 10 HIS 10 7 ? ? ? A . n A 1 11 SER 11 8 ? ? ? A . n A 1 12 SER 12 9 ? ? ? A . n A 1 13 GLY 13 10 ? ? ? A . n A 1 14 LEU 14 11 ? ? ? A . n A 1 15 VAL 15 12 ? ? ? A . n A 1 16 PRO 16 13 ? ? ? A . n A 1 17 ARG 17 14 ? ? ? A . n A 1 18 GLY 18 15 ? ? ? A . n A 1 19 SER 19 16 ? ? ? A . n A 1 20 HIS 20 17 ? ? ? A . n A 1 21 MET 21 18 18 MET MET A . n A 1 22 ALA 22 19 19 ALA ALA A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 CYS 25 22 22 CYS CYS A . n A 1 26 PHE 26 23 23 PHE PHE A . n A 1 27 THR 27 24 24 THR THR A . n A 1 28 ARG 28 25 25 ARG ARG A . n A 1 29 ASN 29 26 26 ASN ASN A . n A 1 30 GLY 30 27 27 GLY GLY A . n A 1 31 ASP 31 28 28 ASP ASP A . n A 1 32 ASP 32 29 29 ASP ASP A . n A 1 33 ARG 33 30 30 ARG ARG A . n A 1 34 THR 34 31 31 THR THR A . n A 1 35 VAL 35 32 32 VAL VAL A . n A 1 36 THR 36 33 33 THR THR A . n A 1 37 THR 37 34 34 THR THR A . n A 1 38 CYS 38 35 35 CYS CYS A . n A 1 39 ALA 39 36 36 ALA ALA A . n A 1 40 GLU 40 37 37 GLU GLU A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 GLN 42 39 39 GLN GLN A . n A 1 43 THR 43 40 40 THR THR A . n A 1 44 ARG 44 41 41 ARG ARG A . n A 1 45 CYS 45 42 42 CYS CYS A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 PHE 47 44 44 PHE PHE A . n A 1 48 VAL 48 45 45 VAL VAL A . n A 1 49 GLN 49 46 46 GLN GLN A . n A 1 50 LEU 50 47 47 LEU LEU A . n A 1 51 PRO 51 48 48 PRO PRO A . n A 1 52 TYR 52 49 49 TYR TYR A . n A 1 53 SER 53 50 50 SER SER A . n A 1 54 GLU 54 51 51 GLU GLU A . n A 1 55 ILE 55 52 52 ILE ILE A . n A 1 56 GLN 56 53 53 GLN GLN A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 CYS 58 55 55 CYS CYS A . n A 1 59 LYS 59 56 56 LYS LYS A . n A 1 60 THR 60 57 57 THR THR A . n A 1 61 VAL 61 58 58 VAL VAL A . n A 1 62 GLN 62 59 59 GLN GLN A . n A 1 63 GLN 63 60 60 GLN GLN A . n A 1 64 CYS 64 61 61 CYS CYS A . n A 1 65 ALA 65 62 62 ALA ALA A . n A 1 66 GLU 66 63 63 GLU GLU A . n A 1 67 VAL 67 64 64 VAL VAL A . n A 1 68 LEU 68 65 65 LEU LEU A . n A 1 69 GLU 69 66 66 GLU GLU A . n A 1 70 GLU 70 67 67 GLU GLU A . n A 1 71 VAL 71 68 68 VAL VAL A . n A 1 72 THR 72 69 69 THR THR A . n A 1 73 ALA 73 70 70 ALA ALA A . n A 1 74 ILE 74 71 71 ILE ILE A . n A 1 75 GLY 75 72 72 GLY GLY A . n A 1 76 TYR 76 73 73 TYR TYR A . n A 1 77 PRO 77 74 74 PRO PRO A . n A 1 78 ALA 78 75 75 ALA ALA A . n A 1 79 LYS 79 76 76 LYS LYS A . n A 1 80 CYS 80 77 77 CYS CYS A . n A 1 81 CYS 81 78 78 CYS CYS A . n A 1 82 CYS 82 79 79 CYS CYS A . n A 1 83 GLU 83 80 80 GLU GLU A . n A 1 84 ASP 84 81 81 ASP ASP A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 CYS 86 83 83 CYS CYS A . n A 1 87 ASN 87 84 84 ASN ASN A . n A 1 88 ARG 88 85 85 ARG ARG A . n A 1 89 SER 89 86 86 SER SER A . n A 1 90 GLU 90 87 87 GLU GLU A . n A 1 91 GLN 91 88 88 GLN GLN A . n # _cell.entry_id 2JVE _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JVE _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JVE _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JVE _struct.title ;Solution structure of the extracellular domain of Prod1, a protein implicated in proximodistal identity during amphibian limb regeneration ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JVE _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Ly-6, three-finger snake toxin, UPAR, CD59, Limb regeneration, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A8D0E6_NOTVI _struct_ref.pdbx_db_accession A8D0E6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JVE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8D0E6 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 88 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 19 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JVE MET A 1 ? UNP A8D0E6 ? ? 'expression tag' -2 1 1 2JVE GLY A 2 ? UNP A8D0E6 ? ? 'expression tag' -1 2 1 2JVE SER A 3 ? UNP A8D0E6 ? ? 'expression tag' 0 3 1 2JVE SER A 4 ? UNP A8D0E6 ? ? 'expression tag' 1 4 1 2JVE HIS A 5 ? UNP A8D0E6 ? ? 'expression tag' 2 5 1 2JVE HIS A 6 ? UNP A8D0E6 ? ? 'expression tag' 3 6 1 2JVE HIS A 7 ? UNP A8D0E6 ? ? 'expression tag' 4 7 1 2JVE HIS A 8 ? UNP A8D0E6 ? ? 'expression tag' 5 8 1 2JVE HIS A 9 ? UNP A8D0E6 ? ? 'expression tag' 6 9 1 2JVE HIS A 10 ? UNP A8D0E6 ? ? 'expression tag' 7 10 1 2JVE SER A 11 ? UNP A8D0E6 ? ? 'expression tag' 8 11 1 2JVE SER A 12 ? UNP A8D0E6 ? ? 'expression tag' 9 12 1 2JVE GLY A 13 ? UNP A8D0E6 ? ? 'expression tag' 10 13 1 2JVE LEU A 14 ? UNP A8D0E6 ? ? 'expression tag' 11 14 1 2JVE VAL A 15 ? UNP A8D0E6 ? ? 'expression tag' 12 15 1 2JVE PRO A 16 ? UNP A8D0E6 ? ? 'expression tag' 13 16 1 2JVE ARG A 17 ? UNP A8D0E6 ? ? 'expression tag' 14 17 1 2JVE GLY A 18 ? UNP A8D0E6 ? ? 'expression tag' 15 18 1 2JVE SER A 19 ? UNP A8D0E6 ? ? 'expression tag' 16 19 1 2JVE HIS A 20 ? UNP A8D0E6 ? ? 'expression tag' 17 20 1 2JVE MET A 21 ? UNP A8D0E6 ? ? 'expression tag' 18 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 60 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 73 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 57 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 70 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 22 A CYS 42 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 35 A CYS 55 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf3 disulf ? ? A CYS 64 SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 61 A CYS 77 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf4 disulf ? ? A CYS 81 SG ? ? ? 1_555 A CYS 86 SG ? ? A CYS 78 A CYS 83 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 25 ? CYS A 45 ? CYS A 22 ? 1_555 CYS A 42 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 38 ? CYS A 58 ? CYS A 35 ? 1_555 CYS A 55 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 64 ? CYS A 80 ? CYS A 61 ? 1_555 CYS A 77 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 81 ? CYS A 86 ? CYS A 78 ? 1_555 CYS A 83 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 23 ? THR A 27 ? LEU A 20 THR A 24 A 2 THR A 34 ? CYS A 38 ? THR A 31 CYS A 35 B 1 GLU A 54 ? LYS A 59 ? GLU A 51 LYS A 56 B 2 ARG A 44 ? GLN A 49 ? ARG A 41 GLN A 46 B 3 ALA A 78 ? CYS A 81 ? ALA A 75 CYS A 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 23 ? N LEU A 20 O CYS A 38 ? O CYS A 35 B 1 2 O GLU A 57 ? O GLU A 54 N LEU A 46 ? N LEU A 43 B 2 3 N PHE A 47 ? N PHE A 44 O LYS A 79 ? O LYS A 76 # _pdbx_entry_details.entry_id 2JVE _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 54 ? ? HZ2 A LYS 56 ? ? 1.52 2 1 HH21 A ARG 25 ? ? OD1 A ASP 28 ? ? 1.56 3 2 HZ1 A LYS 21 ? ? OD1 A ASP 81 ? ? 1.59 4 3 HH11 A ARG 25 ? ? HA A ASP 28 ? ? 1.17 5 3 HH21 A ARG 25 ? ? OE1 A GLU 51 ? ? 1.56 6 4 OE2 A GLU 54 ? ? HZ1 A LYS 56 ? ? 1.58 7 5 HD3 A ARG 41 ? ? HG23 A VAL 58 ? ? 1.30 8 5 HZ2 A LYS 76 ? ? OE1 A GLU 87 ? ? 1.55 9 5 OE1 A GLU 54 ? ? HZ3 A LYS 56 ? ? 1.57 10 6 HD2 A PHE 44 ? ? HD3 A LYS 76 ? ? 1.32 11 6 HZ3 A LYS 21 ? ? OD2 A ASP 81 ? ? 1.55 12 7 OE1 A GLU 54 ? ? HZ3 A LYS 56 ? ? 1.51 13 8 OE2 A GLU 54 ? ? HZ2 A LYS 56 ? ? 1.56 14 8 HH12 A ARG 30 ? ? OE2 A GLU 51 ? ? 1.57 15 9 HZ3 A LYS 76 ? ? OE1 A GLU 87 ? ? 1.53 16 9 HZ1 A LYS 21 ? ? OD2 A ASP 81 ? ? 1.55 17 9 OE1 A GLU 54 ? ? HZ2 A LYS 56 ? ? 1.59 18 9 OE2 A GLU 38 ? ? HE21 A GLN 39 ? ? 1.60 19 10 HZ2 A LYS 76 ? ? OE1 A GLU 87 ? ? 1.57 20 11 OE1 A GLU 51 ? ? HG A SER 86 ? ? 1.59 21 11 HH21 A ARG 25 ? ? OD1 A ASP 28 ? ? 1.59 22 11 OE2 A GLU 80 ? ? HH22 A ARG 85 ? ? 1.59 23 12 H A MET 18 ? ? OE1 A GLU 37 ? ? 1.54 24 12 OE2 A GLU 54 ? ? HZ2 A LYS 56 ? ? 1.59 25 14 HG2 A GLU 80 ? ? H A ASP 81 ? ? 1.34 26 14 OE1 A GLU 54 ? ? HZ1 A LYS 56 ? ? 1.51 27 15 HZ3 A LYS 76 ? ? OE2 A GLU 87 ? ? 1.53 28 16 HH12 A ARG 25 ? ? OE1 A GLU 51 ? ? 1.58 29 17 OE1 A GLU 54 ? ? HZ3 A LYS 56 ? ? 1.52 30 17 HH21 A ARG 25 ? ? OD1 A ASP 28 ? ? 1.58 31 18 HB3 A GLN 46 ? ? HB2 A PRO 74 ? ? 1.23 32 18 OE2 A GLU 54 ? ? HZ3 A LYS 56 ? ? 1.56 33 18 H A MET 18 ? ? OE1 A GLU 37 ? ? 1.59 34 19 OE1 A GLU 54 ? ? HZ3 A LYS 56 ? ? 1.54 35 19 HH12 A ARG 30 ? ? OE1 A GLU 51 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 19 ? ? 67.40 107.76 2 1 TYR A 49 ? ? -139.02 -59.35 3 1 SER A 50 ? ? -121.62 -150.08 4 1 GLU A 80 ? ? 177.63 153.17 5 1 SER A 86 ? ? -153.98 -60.81 6 1 GLU A 87 ? ? -83.58 33.87 7 2 TYR A 49 ? ? -125.00 -65.39 8 3 TYR A 49 ? ? -138.35 -44.43 9 3 SER A 50 ? ? -150.77 -151.39 10 3 GLU A 54 ? ? -174.03 146.10 11 3 GLU A 80 ? ? 179.64 152.04 12 3 ASN A 84 ? ? -60.09 -81.45 13 3 ARG A 85 ? ? 31.96 -123.73 14 4 ASP A 28 ? ? -125.21 -53.37 15 4 GLU A 80 ? ? 173.45 145.08 16 5 ALA A 19 ? ? 67.08 175.38 17 5 ASP A 28 ? ? -77.73 -83.21 18 5 GLN A 39 ? ? -95.50 59.31 19 5 TYR A 49 ? ? -141.15 -45.98 20 5 GLU A 80 ? ? 175.25 147.36 21 6 ASP A 28 ? ? -140.83 -34.85 22 6 PRO A 48 ? ? -75.19 28.54 23 6 TYR A 49 ? ? -172.13 -26.02 24 6 SER A 50 ? ? -149.70 -153.31 25 6 GLU A 80 ? ? 171.26 150.79 26 6 ASN A 84 ? ? -82.82 40.61 27 7 ALA A 19 ? ? 57.05 87.28 28 7 SER A 50 ? ? -169.57 -163.92 29 7 GLU A 80 ? ? 175.13 137.64 30 8 GLN A 39 ? ? -101.10 78.54 31 8 SER A 50 ? ? -169.36 -154.95 32 8 GLU A 80 ? ? 176.85 141.46 33 9 TYR A 49 ? ? -136.55 -55.75 34 9 GLU A 80 ? ? 174.81 148.73 35 10 ALA A 19 ? ? 178.28 154.89 36 10 GLN A 39 ? ? -110.10 52.39 37 10 THR A 40 ? ? -79.85 25.64 38 10 SER A 50 ? ? -161.67 -162.09 39 10 GLU A 80 ? ? 179.06 142.15 40 11 TYR A 49 ? ? -160.46 -48.31 41 11 SER A 50 ? ? -120.55 -153.17 42 11 GLU A 80 ? ? 177.22 161.72 43 12 ASP A 28 ? ? -150.20 -45.16 44 12 GLU A 80 ? ? 173.74 144.16 45 13 ASP A 28 ? ? -144.57 -87.45 46 13 TYR A 49 ? ? -128.38 -64.56 47 13 GLU A 80 ? ? 171.53 149.79 48 13 ASN A 84 ? ? -78.36 37.77 49 13 GLU A 87 ? ? 52.94 81.01 50 14 GLN A 39 ? ? -102.44 72.78 51 14 TYR A 49 ? ? -168.87 -22.41 52 14 SER A 50 ? ? -144.59 -157.40 53 15 ASP A 28 ? ? -140.00 -85.62 54 15 TYR A 49 ? ? -170.63 -23.38 55 15 GLU A 80 ? ? 172.13 151.82 56 16 TYR A 49 ? ? -138.63 -43.75 57 16 SER A 50 ? ? -147.72 -156.71 58 16 GLU A 80 ? ? 178.10 153.71 59 17 ALA A 19 ? ? 71.45 114.03 60 17 ASP A 28 ? ? -127.24 -51.59 61 17 GLN A 39 ? ? -90.98 49.19 62 17 TYR A 49 ? ? -143.45 -39.42 63 17 SER A 50 ? ? -149.11 -156.83 64 17 GLU A 80 ? ? 169.68 155.10 65 18 TYR A 49 ? ? -171.02 -30.94 66 18 SER A 50 ? ? -124.31 -168.40 67 18 GLU A 80 ? ? 178.90 151.01 68 19 ALA A 19 ? ? 63.22 92.12 69 19 GLN A 39 ? ? -103.07 72.54 70 19 TYR A 49 ? ? -140.43 -54.48 71 19 SER A 50 ? ? -137.83 -151.50 72 19 GLU A 80 ? ? 177.84 146.44 73 19 ASN A 84 ? ? -85.07 31.41 74 20 PHE A 23 ? ? -57.23 105.60 75 20 ASP A 28 ? ? -146.40 -21.83 76 20 SER A 50 ? ? -162.31 -157.83 77 20 GLU A 80 ? ? -175.02 146.99 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;Sequence The sequence is not available at UniProt database at the time of processing. ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JVE _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JVE _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-15N] Prod1, 50 mM sodium phosphate, 150 mM sodium chloride, 1 mM EDTA, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-13C; U-15N] Prod1, 50 mM sodium phosphate, 150 mM sodium chloride, 1 mM EDTA, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1 mM [U-13C; U-15N] Prod1, 50 mM sodium phosphate, 150 mM sodium chloride, 1 mM EDTA, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Prod1 1 mM '[U-15N]' 1 'sodium phosphate' 50 mM ? 1 'sodium chloride' 150 mM ? 1 EDTA 1 mM ? 1 Prod1 1 mM '[U-13C; U-15N]' 2 'sodium phosphate' 50 mM ? 2 'sodium chloride' 150 mM ? 2 EDTA 1 mM ? 2 Prod1 1 mM '[U-13C; U-15N]' 3 'sodium phosphate' 50 mM ? 3 'sodium chloride' 150 mM ? 3 EDTA 1 mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 3 '2D 1H-13C HSQC' 1 3 1 '3D 1H-15N NOESY' 1 4 3 '3D 1H-13C NOESY' 1 5 3 '3D 1H-13C aromatic NOESY' 1 6 2 '3D CBCA(CO)NH' 1 7 2 '3D HNCO' 1 8 2 '3D HNCA' 1 9 2 '3D HNCACB' 1 10 2 '3D HN(CO)CA' 1 11 2 '3D HN(CA)CO' 1 12 2 '3D HA(CA)NH' 1 13 2 '3D HN(CACO)NH' 1 14 3 '3D HCCH-TOCSY' 1 15 3 '3D HCCH-COSY' 1 16 1 '3D 1H-15N TOCSY' # _pdbx_nmr_refine.entry_id 2JVE _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ;the structures were calculated using an ab-initio simulated annealing protocol within the CNS/Xplor-NIH programs with PARALLHDG v5.3 parameter set and PROLSQ non-bonded energy function. Cartesian and torsion angle dynamics were used to refine the structures. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, F. et al.' processing NMRPipe ? 1 'Kraulis, P.J.' 'data analysis' ANSIG ? 2 'Schwieters, C.D. et al.' refinement 'X-PLOR NIH' ? 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -2 ? A MET 1 2 1 Y 1 A GLY -1 ? A GLY 2 3 1 Y 1 A SER 0 ? A SER 3 4 1 Y 1 A SER 1 ? A SER 4 5 1 Y 1 A HIS 2 ? A HIS 5 6 1 Y 1 A HIS 3 ? A HIS 6 7 1 Y 1 A HIS 4 ? A HIS 7 8 1 Y 1 A HIS 5 ? A HIS 8 9 1 Y 1 A HIS 6 ? A HIS 9 10 1 Y 1 A HIS 7 ? A HIS 10 11 1 Y 1 A SER 8 ? A SER 11 12 1 Y 1 A SER 9 ? A SER 12 13 1 Y 1 A GLY 10 ? A GLY 13 14 1 Y 1 A LEU 11 ? A LEU 14 15 1 Y 1 A VAL 12 ? A VAL 15 16 1 Y 1 A PRO 13 ? A PRO 16 17 1 Y 1 A ARG 14 ? A ARG 17 18 1 Y 1 A GLY 15 ? A GLY 18 19 1 Y 1 A SER 16 ? A SER 19 20 1 Y 1 A HIS 17 ? A HIS 20 21 2 Y 1 A MET -2 ? A MET 1 22 2 Y 1 A GLY -1 ? A GLY 2 23 2 Y 1 A SER 0 ? A SER 3 24 2 Y 1 A SER 1 ? A SER 4 25 2 Y 1 A HIS 2 ? A HIS 5 26 2 Y 1 A HIS 3 ? A HIS 6 27 2 Y 1 A HIS 4 ? A HIS 7 28 2 Y 1 A HIS 5 ? A HIS 8 29 2 Y 1 A HIS 6 ? A HIS 9 30 2 Y 1 A HIS 7 ? A HIS 10 31 2 Y 1 A SER 8 ? A SER 11 32 2 Y 1 A SER 9 ? A SER 12 33 2 Y 1 A GLY 10 ? A GLY 13 34 2 Y 1 A LEU 11 ? A LEU 14 35 2 Y 1 A VAL 12 ? A VAL 15 36 2 Y 1 A PRO 13 ? A PRO 16 37 2 Y 1 A ARG 14 ? A ARG 17 38 2 Y 1 A GLY 15 ? A GLY 18 39 2 Y 1 A SER 16 ? A SER 19 40 2 Y 1 A HIS 17 ? A HIS 20 41 3 Y 1 A MET -2 ? A MET 1 42 3 Y 1 A GLY -1 ? A GLY 2 43 3 Y 1 A SER 0 ? A SER 3 44 3 Y 1 A SER 1 ? A SER 4 45 3 Y 1 A HIS 2 ? A HIS 5 46 3 Y 1 A HIS 3 ? A HIS 6 47 3 Y 1 A HIS 4 ? A HIS 7 48 3 Y 1 A HIS 5 ? A HIS 8 49 3 Y 1 A HIS 6 ? A HIS 9 50 3 Y 1 A HIS 7 ? A HIS 10 51 3 Y 1 A SER 8 ? A SER 11 52 3 Y 1 A SER 9 ? A SER 12 53 3 Y 1 A GLY 10 ? A GLY 13 54 3 Y 1 A LEU 11 ? A LEU 14 55 3 Y 1 A VAL 12 ? A VAL 15 56 3 Y 1 A PRO 13 ? A PRO 16 57 3 Y 1 A ARG 14 ? A ARG 17 58 3 Y 1 A GLY 15 ? A GLY 18 59 3 Y 1 A SER 16 ? A SER 19 60 3 Y 1 A HIS 17 ? A HIS 20 61 4 Y 1 A MET -2 ? A MET 1 62 4 Y 1 A GLY -1 ? A GLY 2 63 4 Y 1 A SER 0 ? A SER 3 64 4 Y 1 A SER 1 ? A SER 4 65 4 Y 1 A HIS 2 ? A HIS 5 66 4 Y 1 A HIS 3 ? A HIS 6 67 4 Y 1 A HIS 4 ? A HIS 7 68 4 Y 1 A HIS 5 ? A HIS 8 69 4 Y 1 A HIS 6 ? A HIS 9 70 4 Y 1 A HIS 7 ? A HIS 10 71 4 Y 1 A SER 8 ? A SER 11 72 4 Y 1 A SER 9 ? A SER 12 73 4 Y 1 A GLY 10 ? A GLY 13 74 4 Y 1 A LEU 11 ? A LEU 14 75 4 Y 1 A VAL 12 ? A VAL 15 76 4 Y 1 A PRO 13 ? A PRO 16 77 4 Y 1 A ARG 14 ? A ARG 17 78 4 Y 1 A GLY 15 ? A GLY 18 79 4 Y 1 A SER 16 ? A SER 19 80 4 Y 1 A HIS 17 ? A HIS 20 81 5 Y 1 A MET -2 ? A MET 1 82 5 Y 1 A GLY -1 ? A GLY 2 83 5 Y 1 A SER 0 ? A SER 3 84 5 Y 1 A SER 1 ? A SER 4 85 5 Y 1 A HIS 2 ? A HIS 5 86 5 Y 1 A HIS 3 ? A HIS 6 87 5 Y 1 A HIS 4 ? A HIS 7 88 5 Y 1 A HIS 5 ? A HIS 8 89 5 Y 1 A HIS 6 ? A HIS 9 90 5 Y 1 A HIS 7 ? A HIS 10 91 5 Y 1 A SER 8 ? A SER 11 92 5 Y 1 A SER 9 ? A SER 12 93 5 Y 1 A GLY 10 ? A GLY 13 94 5 Y 1 A LEU 11 ? A LEU 14 95 5 Y 1 A VAL 12 ? A VAL 15 96 5 Y 1 A PRO 13 ? A PRO 16 97 5 Y 1 A ARG 14 ? A ARG 17 98 5 Y 1 A GLY 15 ? A GLY 18 99 5 Y 1 A SER 16 ? A SER 19 100 5 Y 1 A HIS 17 ? A HIS 20 101 6 Y 1 A MET -2 ? A MET 1 102 6 Y 1 A GLY -1 ? A GLY 2 103 6 Y 1 A SER 0 ? A SER 3 104 6 Y 1 A SER 1 ? A SER 4 105 6 Y 1 A HIS 2 ? A HIS 5 106 6 Y 1 A HIS 3 ? A HIS 6 107 6 Y 1 A HIS 4 ? A HIS 7 108 6 Y 1 A HIS 5 ? A HIS 8 109 6 Y 1 A HIS 6 ? A HIS 9 110 6 Y 1 A HIS 7 ? A HIS 10 111 6 Y 1 A SER 8 ? A SER 11 112 6 Y 1 A SER 9 ? A SER 12 113 6 Y 1 A GLY 10 ? A GLY 13 114 6 Y 1 A LEU 11 ? A LEU 14 115 6 Y 1 A VAL 12 ? A VAL 15 116 6 Y 1 A PRO 13 ? A PRO 16 117 6 Y 1 A ARG 14 ? A ARG 17 118 6 Y 1 A GLY 15 ? A GLY 18 119 6 Y 1 A SER 16 ? A SER 19 120 6 Y 1 A HIS 17 ? A HIS 20 121 7 Y 1 A MET -2 ? A MET 1 122 7 Y 1 A GLY -1 ? A GLY 2 123 7 Y 1 A SER 0 ? A SER 3 124 7 Y 1 A SER 1 ? A SER 4 125 7 Y 1 A HIS 2 ? A HIS 5 126 7 Y 1 A HIS 3 ? A HIS 6 127 7 Y 1 A HIS 4 ? A HIS 7 128 7 Y 1 A HIS 5 ? A HIS 8 129 7 Y 1 A HIS 6 ? A HIS 9 130 7 Y 1 A HIS 7 ? A HIS 10 131 7 Y 1 A SER 8 ? A SER 11 132 7 Y 1 A SER 9 ? A SER 12 133 7 Y 1 A GLY 10 ? A GLY 13 134 7 Y 1 A LEU 11 ? A LEU 14 135 7 Y 1 A VAL 12 ? A VAL 15 136 7 Y 1 A PRO 13 ? A PRO 16 137 7 Y 1 A ARG 14 ? A ARG 17 138 7 Y 1 A GLY 15 ? A GLY 18 139 7 Y 1 A SER 16 ? A SER 19 140 7 Y 1 A HIS 17 ? A HIS 20 141 8 Y 1 A MET -2 ? A MET 1 142 8 Y 1 A GLY -1 ? A GLY 2 143 8 Y 1 A SER 0 ? A SER 3 144 8 Y 1 A SER 1 ? A SER 4 145 8 Y 1 A HIS 2 ? A HIS 5 146 8 Y 1 A HIS 3 ? A HIS 6 147 8 Y 1 A HIS 4 ? A HIS 7 148 8 Y 1 A HIS 5 ? A HIS 8 149 8 Y 1 A HIS 6 ? A HIS 9 150 8 Y 1 A HIS 7 ? A HIS 10 151 8 Y 1 A SER 8 ? A SER 11 152 8 Y 1 A SER 9 ? A SER 12 153 8 Y 1 A GLY 10 ? A GLY 13 154 8 Y 1 A LEU 11 ? A LEU 14 155 8 Y 1 A VAL 12 ? A VAL 15 156 8 Y 1 A PRO 13 ? A PRO 16 157 8 Y 1 A ARG 14 ? A ARG 17 158 8 Y 1 A GLY 15 ? A GLY 18 159 8 Y 1 A SER 16 ? A SER 19 160 8 Y 1 A HIS 17 ? A HIS 20 161 9 Y 1 A MET -2 ? A MET 1 162 9 Y 1 A GLY -1 ? A GLY 2 163 9 Y 1 A SER 0 ? A SER 3 164 9 Y 1 A SER 1 ? A SER 4 165 9 Y 1 A HIS 2 ? A HIS 5 166 9 Y 1 A HIS 3 ? A HIS 6 167 9 Y 1 A HIS 4 ? A HIS 7 168 9 Y 1 A HIS 5 ? A HIS 8 169 9 Y 1 A HIS 6 ? A HIS 9 170 9 Y 1 A HIS 7 ? A HIS 10 171 9 Y 1 A SER 8 ? A SER 11 172 9 Y 1 A SER 9 ? A SER 12 173 9 Y 1 A GLY 10 ? A GLY 13 174 9 Y 1 A LEU 11 ? A LEU 14 175 9 Y 1 A VAL 12 ? A VAL 15 176 9 Y 1 A PRO 13 ? A PRO 16 177 9 Y 1 A ARG 14 ? A ARG 17 178 9 Y 1 A GLY 15 ? A GLY 18 179 9 Y 1 A SER 16 ? A SER 19 180 9 Y 1 A HIS 17 ? A HIS 20 181 10 Y 1 A MET -2 ? A MET 1 182 10 Y 1 A GLY -1 ? A GLY 2 183 10 Y 1 A SER 0 ? A SER 3 184 10 Y 1 A SER 1 ? A SER 4 185 10 Y 1 A HIS 2 ? A HIS 5 186 10 Y 1 A HIS 3 ? A HIS 6 187 10 Y 1 A HIS 4 ? A HIS 7 188 10 Y 1 A HIS 5 ? A HIS 8 189 10 Y 1 A HIS 6 ? A HIS 9 190 10 Y 1 A HIS 7 ? A HIS 10 191 10 Y 1 A SER 8 ? A SER 11 192 10 Y 1 A SER 9 ? A SER 12 193 10 Y 1 A GLY 10 ? A GLY 13 194 10 Y 1 A LEU 11 ? A LEU 14 195 10 Y 1 A VAL 12 ? A VAL 15 196 10 Y 1 A PRO 13 ? A PRO 16 197 10 Y 1 A ARG 14 ? A ARG 17 198 10 Y 1 A GLY 15 ? A GLY 18 199 10 Y 1 A SER 16 ? A SER 19 200 10 Y 1 A HIS 17 ? A HIS 20 201 11 Y 1 A MET -2 ? A MET 1 202 11 Y 1 A GLY -1 ? A GLY 2 203 11 Y 1 A SER 0 ? A SER 3 204 11 Y 1 A SER 1 ? A SER 4 205 11 Y 1 A HIS 2 ? A HIS 5 206 11 Y 1 A HIS 3 ? A HIS 6 207 11 Y 1 A HIS 4 ? A HIS 7 208 11 Y 1 A HIS 5 ? A HIS 8 209 11 Y 1 A HIS 6 ? A HIS 9 210 11 Y 1 A HIS 7 ? A HIS 10 211 11 Y 1 A SER 8 ? A SER 11 212 11 Y 1 A SER 9 ? A SER 12 213 11 Y 1 A GLY 10 ? A GLY 13 214 11 Y 1 A LEU 11 ? A LEU 14 215 11 Y 1 A VAL 12 ? A VAL 15 216 11 Y 1 A PRO 13 ? A PRO 16 217 11 Y 1 A ARG 14 ? A ARG 17 218 11 Y 1 A GLY 15 ? A GLY 18 219 11 Y 1 A SER 16 ? A SER 19 220 11 Y 1 A HIS 17 ? A HIS 20 221 12 Y 1 A MET -2 ? A MET 1 222 12 Y 1 A GLY -1 ? A GLY 2 223 12 Y 1 A SER 0 ? A SER 3 224 12 Y 1 A SER 1 ? A SER 4 225 12 Y 1 A HIS 2 ? A HIS 5 226 12 Y 1 A HIS 3 ? A HIS 6 227 12 Y 1 A HIS 4 ? A HIS 7 228 12 Y 1 A HIS 5 ? A HIS 8 229 12 Y 1 A HIS 6 ? A HIS 9 230 12 Y 1 A HIS 7 ? A HIS 10 231 12 Y 1 A SER 8 ? A SER 11 232 12 Y 1 A SER 9 ? A SER 12 233 12 Y 1 A GLY 10 ? A GLY 13 234 12 Y 1 A LEU 11 ? A LEU 14 235 12 Y 1 A VAL 12 ? A VAL 15 236 12 Y 1 A PRO 13 ? A PRO 16 237 12 Y 1 A ARG 14 ? A ARG 17 238 12 Y 1 A GLY 15 ? A GLY 18 239 12 Y 1 A SER 16 ? A SER 19 240 12 Y 1 A HIS 17 ? A HIS 20 241 13 Y 1 A MET -2 ? A MET 1 242 13 Y 1 A GLY -1 ? A GLY 2 243 13 Y 1 A SER 0 ? A SER 3 244 13 Y 1 A SER 1 ? A SER 4 245 13 Y 1 A HIS 2 ? A HIS 5 246 13 Y 1 A HIS 3 ? A HIS 6 247 13 Y 1 A HIS 4 ? A HIS 7 248 13 Y 1 A HIS 5 ? A HIS 8 249 13 Y 1 A HIS 6 ? A HIS 9 250 13 Y 1 A HIS 7 ? A HIS 10 251 13 Y 1 A SER 8 ? A SER 11 252 13 Y 1 A SER 9 ? A SER 12 253 13 Y 1 A GLY 10 ? A GLY 13 254 13 Y 1 A LEU 11 ? A LEU 14 255 13 Y 1 A VAL 12 ? A VAL 15 256 13 Y 1 A PRO 13 ? A PRO 16 257 13 Y 1 A ARG 14 ? A ARG 17 258 13 Y 1 A GLY 15 ? A GLY 18 259 13 Y 1 A SER 16 ? A SER 19 260 13 Y 1 A HIS 17 ? A HIS 20 261 14 Y 1 A MET -2 ? A MET 1 262 14 Y 1 A GLY -1 ? A GLY 2 263 14 Y 1 A SER 0 ? A SER 3 264 14 Y 1 A SER 1 ? A SER 4 265 14 Y 1 A HIS 2 ? A HIS 5 266 14 Y 1 A HIS 3 ? A HIS 6 267 14 Y 1 A HIS 4 ? A HIS 7 268 14 Y 1 A HIS 5 ? A HIS 8 269 14 Y 1 A HIS 6 ? A HIS 9 270 14 Y 1 A HIS 7 ? A HIS 10 271 14 Y 1 A SER 8 ? A SER 11 272 14 Y 1 A SER 9 ? A SER 12 273 14 Y 1 A GLY 10 ? A GLY 13 274 14 Y 1 A LEU 11 ? A LEU 14 275 14 Y 1 A VAL 12 ? A VAL 15 276 14 Y 1 A PRO 13 ? A PRO 16 277 14 Y 1 A ARG 14 ? A ARG 17 278 14 Y 1 A GLY 15 ? A GLY 18 279 14 Y 1 A SER 16 ? A SER 19 280 14 Y 1 A HIS 17 ? A HIS 20 281 15 Y 1 A MET -2 ? A MET 1 282 15 Y 1 A GLY -1 ? A GLY 2 283 15 Y 1 A SER 0 ? A SER 3 284 15 Y 1 A SER 1 ? A SER 4 285 15 Y 1 A HIS 2 ? A HIS 5 286 15 Y 1 A HIS 3 ? A HIS 6 287 15 Y 1 A HIS 4 ? A HIS 7 288 15 Y 1 A HIS 5 ? A HIS 8 289 15 Y 1 A HIS 6 ? A HIS 9 290 15 Y 1 A HIS 7 ? A HIS 10 291 15 Y 1 A SER 8 ? A SER 11 292 15 Y 1 A SER 9 ? A SER 12 293 15 Y 1 A GLY 10 ? A GLY 13 294 15 Y 1 A LEU 11 ? A LEU 14 295 15 Y 1 A VAL 12 ? A VAL 15 296 15 Y 1 A PRO 13 ? A PRO 16 297 15 Y 1 A ARG 14 ? A ARG 17 298 15 Y 1 A GLY 15 ? A GLY 18 299 15 Y 1 A SER 16 ? A SER 19 300 15 Y 1 A HIS 17 ? A HIS 20 301 16 Y 1 A MET -2 ? A MET 1 302 16 Y 1 A GLY -1 ? A GLY 2 303 16 Y 1 A SER 0 ? A SER 3 304 16 Y 1 A SER 1 ? A SER 4 305 16 Y 1 A HIS 2 ? A HIS 5 306 16 Y 1 A HIS 3 ? A HIS 6 307 16 Y 1 A HIS 4 ? A HIS 7 308 16 Y 1 A HIS 5 ? A HIS 8 309 16 Y 1 A HIS 6 ? A HIS 9 310 16 Y 1 A HIS 7 ? A HIS 10 311 16 Y 1 A SER 8 ? A SER 11 312 16 Y 1 A SER 9 ? A SER 12 313 16 Y 1 A GLY 10 ? A GLY 13 314 16 Y 1 A LEU 11 ? A LEU 14 315 16 Y 1 A VAL 12 ? A VAL 15 316 16 Y 1 A PRO 13 ? A PRO 16 317 16 Y 1 A ARG 14 ? A ARG 17 318 16 Y 1 A GLY 15 ? A GLY 18 319 16 Y 1 A SER 16 ? A SER 19 320 16 Y 1 A HIS 17 ? A HIS 20 321 17 Y 1 A MET -2 ? A MET 1 322 17 Y 1 A GLY -1 ? A GLY 2 323 17 Y 1 A SER 0 ? A SER 3 324 17 Y 1 A SER 1 ? A SER 4 325 17 Y 1 A HIS 2 ? A HIS 5 326 17 Y 1 A HIS 3 ? A HIS 6 327 17 Y 1 A HIS 4 ? A HIS 7 328 17 Y 1 A HIS 5 ? A HIS 8 329 17 Y 1 A HIS 6 ? A HIS 9 330 17 Y 1 A HIS 7 ? A HIS 10 331 17 Y 1 A SER 8 ? A SER 11 332 17 Y 1 A SER 9 ? A SER 12 333 17 Y 1 A GLY 10 ? A GLY 13 334 17 Y 1 A LEU 11 ? A LEU 14 335 17 Y 1 A VAL 12 ? A VAL 15 336 17 Y 1 A PRO 13 ? A PRO 16 337 17 Y 1 A ARG 14 ? A ARG 17 338 17 Y 1 A GLY 15 ? A GLY 18 339 17 Y 1 A SER 16 ? A SER 19 340 17 Y 1 A HIS 17 ? A HIS 20 341 18 Y 1 A MET -2 ? A MET 1 342 18 Y 1 A GLY -1 ? A GLY 2 343 18 Y 1 A SER 0 ? A SER 3 344 18 Y 1 A SER 1 ? A SER 4 345 18 Y 1 A HIS 2 ? A HIS 5 346 18 Y 1 A HIS 3 ? A HIS 6 347 18 Y 1 A HIS 4 ? A HIS 7 348 18 Y 1 A HIS 5 ? A HIS 8 349 18 Y 1 A HIS 6 ? A HIS 9 350 18 Y 1 A HIS 7 ? A HIS 10 351 18 Y 1 A SER 8 ? A SER 11 352 18 Y 1 A SER 9 ? A SER 12 353 18 Y 1 A GLY 10 ? A GLY 13 354 18 Y 1 A LEU 11 ? A LEU 14 355 18 Y 1 A VAL 12 ? A VAL 15 356 18 Y 1 A PRO 13 ? A PRO 16 357 18 Y 1 A ARG 14 ? A ARG 17 358 18 Y 1 A GLY 15 ? A GLY 18 359 18 Y 1 A SER 16 ? A SER 19 360 18 Y 1 A HIS 17 ? A HIS 20 361 19 Y 1 A MET -2 ? A MET 1 362 19 Y 1 A GLY -1 ? A GLY 2 363 19 Y 1 A SER 0 ? A SER 3 364 19 Y 1 A SER 1 ? A SER 4 365 19 Y 1 A HIS 2 ? A HIS 5 366 19 Y 1 A HIS 3 ? A HIS 6 367 19 Y 1 A HIS 4 ? A HIS 7 368 19 Y 1 A HIS 5 ? A HIS 8 369 19 Y 1 A HIS 6 ? A HIS 9 370 19 Y 1 A HIS 7 ? A HIS 10 371 19 Y 1 A SER 8 ? A SER 11 372 19 Y 1 A SER 9 ? A SER 12 373 19 Y 1 A GLY 10 ? A GLY 13 374 19 Y 1 A LEU 11 ? A LEU 14 375 19 Y 1 A VAL 12 ? A VAL 15 376 19 Y 1 A PRO 13 ? A PRO 16 377 19 Y 1 A ARG 14 ? A ARG 17 378 19 Y 1 A GLY 15 ? A GLY 18 379 19 Y 1 A SER 16 ? A SER 19 380 19 Y 1 A HIS 17 ? A HIS 20 381 20 Y 1 A MET -2 ? A MET 1 382 20 Y 1 A GLY -1 ? A GLY 2 383 20 Y 1 A SER 0 ? A SER 3 384 20 Y 1 A SER 1 ? A SER 4 385 20 Y 1 A HIS 2 ? A HIS 5 386 20 Y 1 A HIS 3 ? A HIS 6 387 20 Y 1 A HIS 4 ? A HIS 7 388 20 Y 1 A HIS 5 ? A HIS 8 389 20 Y 1 A HIS 6 ? A HIS 9 390 20 Y 1 A HIS 7 ? A HIS 10 391 20 Y 1 A SER 8 ? A SER 11 392 20 Y 1 A SER 9 ? A SER 12 393 20 Y 1 A GLY 10 ? A GLY 13 394 20 Y 1 A LEU 11 ? A LEU 14 395 20 Y 1 A VAL 12 ? A VAL 15 396 20 Y 1 A PRO 13 ? A PRO 16 397 20 Y 1 A ARG 14 ? A ARG 17 398 20 Y 1 A GLY 15 ? A GLY 18 399 20 Y 1 A SER 16 ? A SER 19 400 20 Y 1 A HIS 17 ? A HIS 20 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' 500 Varian UNITYPLUS 4 'Varian UnityPlus' # _atom_sites.entry_id 2JVE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_