data_2JX2 # _entry.id 2JX2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JX2 pdb_00002jx2 10.2210/pdb2jx2/pdb RCSB RCSB100398 ? ? WWPDB D_1000100398 ? ? BMRB 15543 ? ? # _pdbx_database_related.db_id 15543 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JX2 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-11-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jampani, N.' 1 'Schweimer, K.' 2 'Wenzel, S.' 3 'Woehrl, B.M.' 4 'Roesch, P.' 5 # _citation.id primary _citation.title 'NELF-E RRM Undergoes Major Structural Changes in Flexible Protein Regions on Target RNA Binding' _citation.journal_abbrev Biochemistry _citation.journal_volume 47 _citation.page_first 3756 _citation.page_last 3761 _citation.year 2008 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18303858 _citation.pdbx_database_id_DOI 10.1021/bi702429m # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rao, J.N.' 1 ? primary 'Schweimer, K.' 2 ? primary 'Wenzel, S.' 3 ? primary 'Wohrl, B.M.' 4 ? primary 'Rosch, P.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Negative elongation factor E' _entity.formula_weight 13384.088 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RRM domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NELF-E, RNA-binding protein RD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTY EKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTY EKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLY n 1 23 PRO n 1 24 PHE n 1 25 ARG n 1 26 ARG n 1 27 SER n 1 28 ASP n 1 29 SER n 1 30 PHE n 1 31 PRO n 1 32 GLU n 1 33 ARG n 1 34 ARG n 1 35 ALA n 1 36 PRO n 1 37 ARG n 1 38 LYS n 1 39 GLY n 1 40 ASN n 1 41 THR n 1 42 LEU n 1 43 TYR n 1 44 VAL n 1 45 TYR n 1 46 GLY n 1 47 GLU n 1 48 ASP n 1 49 MET n 1 50 THR n 1 51 PRO n 1 52 THR n 1 53 LEU n 1 54 LEU n 1 55 ARG n 1 56 GLY n 1 57 ALA n 1 58 PHE n 1 59 SER n 1 60 PRO n 1 61 PHE n 1 62 GLY n 1 63 ASN n 1 64 ILE n 1 65 ILE n 1 66 ASP n 1 67 LEU n 1 68 SER n 1 69 MET n 1 70 ASP n 1 71 PRO n 1 72 PRO n 1 73 ARG n 1 74 ASN n 1 75 CYS n 1 76 ALA n 1 77 PHE n 1 78 VAL n 1 79 THR n 1 80 TYR n 1 81 GLU n 1 82 LYS n 1 83 MET n 1 84 GLU n 1 85 SER n 1 86 ALA n 1 87 ASP n 1 88 GLN n 1 89 ALA n 1 90 VAL n 1 91 ALA n 1 92 GLU n 1 93 LEU n 1 94 ASN n 1 95 GLY n 1 96 THR n 1 97 GLN n 1 98 VAL n 1 99 GLU n 1 100 SER n 1 101 VAL n 1 102 GLN n 1 103 LEU n 1 104 LYS n 1 105 VAL n 1 106 ASN n 1 107 ILE n 1 108 ALA n 1 109 ARG n 1 110 LYS n 1 111 GLN n 1 112 PRO n 1 113 MET n 1 114 LEU n 1 115 ASP n 1 116 ALA n 1 117 ALA n 1 118 THR n 1 119 GLY n 1 120 LYS n 1 121 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'RDBP, NELFE, RD' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NELFE_HUMAN _struct_ref.pdbx_db_accession P18615 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESV QLKVNIARKQPMLDAATGKS ; _struct_ref.pdbx_align_begin 244 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JX2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 121 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18615 _struct_ref_seq.db_align_beg 244 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 343 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JX2 MET A 1 ? UNP P18615 ? ? 'expression tag' 1 1 1 2JX2 GLY A 2 ? UNP P18615 ? ? 'expression tag' 2 2 1 2JX2 SER A 3 ? UNP P18615 ? ? 'expression tag' 3 3 1 2JX2 SER A 4 ? UNP P18615 ? ? 'expression tag' 4 4 1 2JX2 HIS A 5 ? UNP P18615 ? ? 'expression tag' 5 5 1 2JX2 HIS A 6 ? UNP P18615 ? ? 'expression tag' 6 6 1 2JX2 HIS A 7 ? UNP P18615 ? ? 'expression tag' 7 7 1 2JX2 HIS A 8 ? UNP P18615 ? ? 'expression tag' 8 8 1 2JX2 HIS A 9 ? UNP P18615 ? ? 'expression tag' 9 9 1 2JX2 HIS A 10 ? UNP P18615 ? ? 'expression tag' 10 10 1 2JX2 SER A 11 ? UNP P18615 ? ? 'expression tag' 11 11 1 2JX2 SER A 12 ? UNP P18615 ? ? 'expression tag' 12 12 1 2JX2 GLY A 13 ? UNP P18615 ? ? 'expression tag' 13 13 1 2JX2 LEU A 14 ? UNP P18615 ? ? 'expression tag' 14 14 1 2JX2 VAL A 15 ? UNP P18615 ? ? 'expression tag' 15 15 1 2JX2 PRO A 16 ? UNP P18615 ? ? 'expression tag' 16 16 1 2JX2 ARG A 17 ? UNP P18615 ? ? 'expression tag' 17 17 1 2JX2 GLY A 18 ? UNP P18615 ? ? 'expression tag' 18 18 1 2JX2 SER A 19 ? UNP P18615 ? ? 'expression tag' 19 19 1 2JX2 HIS A 20 ? UNP P18615 ? ? 'expression tag' 20 20 1 2JX2 MET A 21 ? UNP P18615 ? ? 'expression tag' 21 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HCCH-TOCSY' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.4 mM [U-98% 13C; U-98% 15N] rna bound nelfe-rrm, 0.8 mM TAR(49-57), 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2JX2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 160 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JX2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JX2 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 1 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 2 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JX2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JX2 _struct.title 'Solution conformation of RNA-bound NELF-E RRM' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JX2 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'nelfe-rrm, Coiled coil, Nucleus, Phosphorylation, Repressor, RNA-binding, Transcription, Transcription regulation, Ubl conjugation' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 50 ? SER A 59 ? THR A 50 SER A 59 1 ? 10 HELX_P HELX_P2 2 LYS A 82 ? ASN A 94 ? LYS A 82 ASN A 94 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 64 ? ASP A 70 ? ILE A 64 ASP A 70 A 2 CYS A 75 ? TYR A 80 ? CYS A 75 TYR A 80 A 3 ASN A 40 ? TYR A 45 ? ASN A 40 TYR A 45 A 4 GLN A 102 ? ILE A 107 ? GLN A 102 ILE A 107 A 5 THR A 96 ? GLN A 97 ? THR A 96 GLN A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 68 ? N SER A 68 O PHE A 77 ? O PHE A 77 A 2 3 O TYR A 80 ? O TYR A 80 N ASN A 40 ? N ASN A 40 A 3 4 N TYR A 43 ? N TYR A 43 O ASN A 106 ? O ASN A 106 A 4 5 O LEU A 103 ? O LEU A 103 N THR A 96 ? N THR A 96 # _atom_sites.entry_id 2JX2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 MET 21 21 ? ? ? A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 PRO 23 23 ? ? ? A . n A 1 24 PHE 24 24 ? ? ? A . n A 1 25 ARG 25 25 ? ? ? A . n A 1 26 ARG 26 26 ? ? ? A . n A 1 27 SER 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 SER 29 29 ? ? ? A . n A 1 30 PHE 30 30 ? ? ? A . n A 1 31 PRO 31 31 ? ? ? A . n A 1 32 GLU 32 32 ? ? ? A . n A 1 33 ARG 33 33 ? ? ? A . n A 1 34 ARG 34 34 ? ? ? A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'rna bound nelfe-rrm' 0.4 mM '[U-98% 13C; U-98% 15N]' 1 'TAR(49-57)' 0.8 mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ASN 40 ? ? O A TYR 80 ? ? 1.58 2 1 O A SER 68 ? ? H A PHE 77 ? ? 1.59 3 2 O A ALA 89 ? ? H A LEU 93 ? ? 1.58 4 3 H A GLY 39 ? ? O A ALA 116 ? ? 1.60 5 3 O A ALA 89 ? ? H A LEU 93 ? ? 1.60 6 4 O A SER 68 ? ? H A PHE 77 ? ? 1.58 7 4 H A ASN 40 ? ? O A TYR 80 ? ? 1.58 8 4 H A VAL 98 ? ? O A VAL 101 ? ? 1.58 9 5 O A SER 68 ? ? H A PHE 77 ? ? 1.57 10 6 H A GLY 39 ? ? O A ALA 116 ? ? 1.58 11 6 O A TYR 43 ? ? H A ASN 106 ? ? 1.59 12 7 O A ASN 40 ? ? H A TYR 80 ? ? 1.55 13 7 O A ALA 89 ? ? H A LEU 93 ? ? 1.58 14 7 O A SER 68 ? ? H A PHE 77 ? ? 1.58 15 8 H A ASN 40 ? ? O A TYR 80 ? ? 1.57 16 9 H A VAL 98 ? ? O A VAL 101 ? ? 1.59 17 11 O A SER 68 ? ? H A PHE 77 ? ? 1.58 18 12 H A ASN 40 ? ? O A TYR 80 ? ? 1.58 19 12 O A ALA 86 ? ? H A VAL 90 ? ? 1.58 20 12 O A SER 68 ? ? H A PHE 77 ? ? 1.58 21 13 O A TYR 43 ? ? H A ASN 106 ? ? 1.57 22 13 H A LEU 42 ? ? O A VAL 78 ? ? 1.58 23 13 H A ASN 40 ? ? O A TYR 80 ? ? 1.60 24 14 H A VAL 98 ? ? O A VAL 101 ? ? 1.60 25 15 H A ASN 40 ? ? O A TYR 80 ? ? 1.58 26 16 O A SER 68 ? ? H A PHE 77 ? ? 1.59 27 16 H A VAL 98 ? ? O A VAL 101 ? ? 1.60 28 17 O A ALA 86 ? ? H A VAL 90 ? ? 1.57 29 18 O A SER 68 ? ? H A PHE 77 ? ? 1.58 30 18 H A VAL 98 ? ? O A VAL 101 ? ? 1.59 31 19 O A TYR 43 ? ? H A ASN 106 ? ? 1.54 32 19 O A ALA 89 ? ? H A LEU 93 ? ? 1.57 33 19 O A ALA 86 ? ? H A VAL 90 ? ? 1.60 34 20 O A SER 68 ? ? H A PHE 77 ? ? 1.56 35 20 H A ASN 40 ? ? O A TYR 80 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 98 ? ? -85.23 -154.31 2 1 SER A 100 ? ? -153.72 24.75 3 1 GLN A 111 ? ? 75.69 46.51 4 1 LEU A 114 ? ? -155.53 20.02 5 1 ALA A 116 ? ? 78.02 -76.31 6 1 ALA A 117 ? ? -165.62 -148.35 7 2 VAL A 98 ? ? -92.40 -148.84 8 2 SER A 100 ? ? -165.82 30.64 9 2 ARG A 109 ? ? -99.77 33.64 10 2 ALA A 116 ? ? 70.29 -84.03 11 2 ALA A 117 ? ? -162.69 24.18 12 3 LYS A 38 ? ? -122.94 -157.26 13 3 VAL A 98 ? ? -101.59 -151.92 14 3 SER A 100 ? ? -165.98 25.84 15 3 GLN A 111 ? ? -42.40 98.56 16 3 LEU A 114 ? ? -150.68 26.93 17 3 ALA A 116 ? ? 72.30 -83.12 18 4 LYS A 38 ? ? -69.19 -167.73 19 4 VAL A 98 ? ? -81.13 -151.99 20 4 SER A 100 ? ? -158.10 22.81 21 4 GLN A 111 ? ? 75.61 47.90 22 4 LEU A 114 ? ? -148.49 17.47 23 4 ASP A 115 ? ? 39.92 45.24 24 4 ALA A 116 ? ? 76.66 -66.60 25 5 LYS A 38 ? ? 44.49 -162.50 26 5 VAL A 98 ? ? -108.56 -153.31 27 5 SER A 100 ? ? -162.86 25.48 28 5 GLN A 111 ? ? -119.08 73.33 29 5 LEU A 114 ? ? -142.66 25.96 30 5 ALA A 116 ? ? 62.80 -77.98 31 6 LYS A 38 ? ? -111.57 -163.21 32 6 GLU A 81 ? ? -38.88 -34.54 33 6 VAL A 98 ? ? -81.79 -157.48 34 6 SER A 100 ? ? -155.04 24.04 35 6 LEU A 114 ? ? -176.01 29.78 36 6 ALA A 116 ? ? 75.62 -82.32 37 6 ALA A 117 ? ? -167.03 -166.05 38 7 LYS A 38 ? ? -78.87 -166.01 39 7 ASN A 40 ? ? -171.23 113.22 40 7 VAL A 98 ? ? -113.26 -160.25 41 7 SER A 100 ? ? -164.90 28.59 42 7 LEU A 114 ? ? -147.69 26.87 43 7 ALA A 116 ? ? 72.08 -80.57 44 8 LYS A 38 ? ? -55.36 -170.02 45 8 SER A 100 ? ? -155.59 25.18 46 8 ALA A 108 ? ? -114.62 -150.99 47 8 GLN A 111 ? ? 61.42 98.03 48 8 LEU A 114 ? ? -173.07 29.21 49 8 ALA A 116 ? ? 76.72 -78.18 50 8 ALA A 117 ? ? -176.51 30.29 51 9 LYS A 38 ? ? -100.32 -169.06 52 9 ASN A 40 ? ? -162.37 111.65 53 9 VAL A 98 ? ? -87.39 -147.80 54 9 SER A 100 ? ? -153.77 23.83 55 9 LEU A 114 ? ? -148.25 25.89 56 9 ALA A 116 ? ? 44.84 -95.52 57 9 ALA A 117 ? ? -173.11 -75.70 58 10 VAL A 98 ? ? -80.12 -153.55 59 10 SER A 100 ? ? -156.96 25.78 60 10 LEU A 114 ? ? -174.41 29.25 61 10 ALA A 116 ? ? 76.03 -79.80 62 10 ALA A 117 ? ? -165.37 24.98 63 11 LYS A 38 ? ? -63.51 -168.86 64 11 ASN A 40 ? ? -165.80 115.31 65 11 VAL A 98 ? ? -83.83 -149.49 66 11 SER A 100 ? ? -158.51 31.55 67 11 LYS A 110 ? ? -68.68 -162.98 68 11 GLN A 111 ? ? 70.52 61.10 69 11 LEU A 114 ? ? 178.07 31.78 70 11 ALA A 116 ? ? 68.46 -84.49 71 12 LYS A 38 ? ? -104.14 -167.04 72 12 VAL A 98 ? ? -100.29 -148.72 73 12 SER A 100 ? ? -159.36 31.56 74 12 ARG A 109 ? ? -99.81 33.01 75 12 LEU A 114 ? ? -148.27 22.99 76 12 ALA A 116 ? ? 76.55 -72.05 77 12 ALA A 117 ? ? -169.88 68.23 78 13 VAL A 98 ? ? -93.78 -148.68 79 13 SER A 100 ? ? -157.20 21.21 80 13 LYS A 110 ? ? -173.09 34.03 81 13 LEU A 114 ? ? -161.59 27.77 82 13 ALA A 116 ? ? 76.16 -74.85 83 14 LYS A 38 ? ? -77.36 -165.04 84 14 VAL A 98 ? ? -98.33 -152.58 85 14 SER A 100 ? ? -157.60 24.85 86 14 LEU A 114 ? ? 178.27 31.69 87 14 ALA A 116 ? ? 77.55 -78.54 88 15 LYS A 38 ? ? -69.89 -173.81 89 15 ASP A 66 ? ? -160.64 106.13 90 15 VAL A 98 ? ? -97.73 -151.30 91 15 SER A 100 ? ? -164.00 30.35 92 15 LEU A 114 ? ? -170.18 25.38 93 15 ALA A 116 ? ? 78.72 -71.57 94 15 ALA A 117 ? ? -167.45 -80.03 95 16 LYS A 38 ? ? -108.17 -166.72 96 16 VAL A 98 ? ? -80.13 -148.48 97 16 SER A 100 ? ? -155.99 25.52 98 16 ARG A 109 ? ? -46.32 151.29 99 16 LEU A 114 ? ? -146.29 24.02 100 16 ALA A 116 ? ? 57.83 -89.10 101 16 ALA A 117 ? ? -177.69 30.61 102 17 LYS A 38 ? ? -79.45 -163.09 103 17 ASN A 40 ? ? 178.25 113.83 104 17 VAL A 98 ? ? -90.79 -159.41 105 17 SER A 100 ? ? -159.86 25.96 106 17 LEU A 114 ? ? -179.03 31.40 107 17 ALA A 116 ? ? 68.93 -86.71 108 17 ALA A 117 ? ? -172.90 -34.78 109 18 LYS A 38 ? ? -64.25 -173.33 110 18 VAL A 98 ? ? -106.19 -155.13 111 18 SER A 100 ? ? -160.95 23.28 112 18 GLN A 111 ? ? -113.94 57.16 113 18 LEU A 114 ? ? -153.59 17.70 114 18 ALA A 116 ? ? 79.62 -74.82 115 18 ALA A 117 ? ? -168.48 59.11 116 19 VAL A 98 ? ? -83.01 -148.53 117 19 SER A 100 ? ? -161.13 23.53 118 19 LEU A 114 ? ? -164.64 26.80 119 19 ALA A 116 ? ? 73.30 -83.61 120 19 ALA A 117 ? ? -171.58 27.90 121 20 LYS A 38 ? ? 44.60 -168.20 122 20 VAL A 98 ? ? -100.22 -158.18 123 20 SER A 100 ? ? -159.66 28.29 124 20 ALA A 108 ? ? -92.42 -156.71 125 20 ARG A 109 ? ? -47.07 164.85 126 20 GLN A 111 ? ? 55.76 100.29 127 20 LEU A 114 ? ? -169.03 27.21 128 20 ALA A 116 ? ? 77.03 -77.61 129 20 ALA A 117 ? ? -167.77 65.95 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 37 ? ? 0.276 'SIDE CHAIN' 2 1 ARG A 55 ? ? 0.191 'SIDE CHAIN' 3 1 ARG A 73 ? ? 0.310 'SIDE CHAIN' 4 2 ARG A 37 ? ? 0.218 'SIDE CHAIN' 5 2 ARG A 55 ? ? 0.255 'SIDE CHAIN' 6 2 ARG A 73 ? ? 0.202 'SIDE CHAIN' 7 2 ARG A 109 ? ? 0.310 'SIDE CHAIN' 8 3 ARG A 37 ? ? 0.306 'SIDE CHAIN' 9 3 ARG A 73 ? ? 0.283 'SIDE CHAIN' 10 3 ARG A 109 ? ? 0.267 'SIDE CHAIN' 11 4 ARG A 37 ? ? 0.258 'SIDE CHAIN' 12 4 ARG A 55 ? ? 0.288 'SIDE CHAIN' 13 4 ARG A 73 ? ? 0.283 'SIDE CHAIN' 14 4 ARG A 109 ? ? 0.212 'SIDE CHAIN' 15 5 ARG A 37 ? ? 0.162 'SIDE CHAIN' 16 5 ARG A 55 ? ? 0.306 'SIDE CHAIN' 17 5 ARG A 73 ? ? 0.193 'SIDE CHAIN' 18 5 ARG A 109 ? ? 0.277 'SIDE CHAIN' 19 6 ARG A 37 ? ? 0.313 'SIDE CHAIN' 20 6 ARG A 55 ? ? 0.167 'SIDE CHAIN' 21 6 ARG A 73 ? ? 0.298 'SIDE CHAIN' 22 6 ARG A 109 ? ? 0.123 'SIDE CHAIN' 23 7 ARG A 37 ? ? 0.317 'SIDE CHAIN' 24 7 ARG A 55 ? ? 0.306 'SIDE CHAIN' 25 7 ARG A 73 ? ? 0.164 'SIDE CHAIN' 26 7 ARG A 109 ? ? 0.292 'SIDE CHAIN' 27 8 ARG A 37 ? ? 0.177 'SIDE CHAIN' 28 8 ARG A 55 ? ? 0.290 'SIDE CHAIN' 29 8 ARG A 73 ? ? 0.241 'SIDE CHAIN' 30 8 ARG A 109 ? ? 0.218 'SIDE CHAIN' 31 9 ARG A 55 ? ? 0.153 'SIDE CHAIN' 32 9 ARG A 73 ? ? 0.313 'SIDE CHAIN' 33 9 ARG A 109 ? ? 0.238 'SIDE CHAIN' 34 10 ARG A 37 ? ? 0.312 'SIDE CHAIN' 35 10 ARG A 55 ? ? 0.315 'SIDE CHAIN' 36 10 ARG A 73 ? ? 0.317 'SIDE CHAIN' 37 10 ARG A 109 ? ? 0.198 'SIDE CHAIN' 38 11 ARG A 37 ? ? 0.311 'SIDE CHAIN' 39 11 ARG A 55 ? ? 0.316 'SIDE CHAIN' 40 11 ARG A 73 ? ? 0.293 'SIDE CHAIN' 41 11 ARG A 109 ? ? 0.279 'SIDE CHAIN' 42 12 ARG A 37 ? ? 0.310 'SIDE CHAIN' 43 12 ARG A 55 ? ? 0.252 'SIDE CHAIN' 44 12 ARG A 73 ? ? 0.123 'SIDE CHAIN' 45 12 ARG A 109 ? ? 0.316 'SIDE CHAIN' 46 13 ARG A 37 ? ? 0.078 'SIDE CHAIN' 47 13 ARG A 55 ? ? 0.084 'SIDE CHAIN' 48 13 ARG A 73 ? ? 0.169 'SIDE CHAIN' 49 13 ARG A 109 ? ? 0.298 'SIDE CHAIN' 50 14 ARG A 55 ? ? 0.195 'SIDE CHAIN' 51 14 ARG A 73 ? ? 0.307 'SIDE CHAIN' 52 14 ARG A 109 ? ? 0.149 'SIDE CHAIN' 53 15 ARG A 37 ? ? 0.303 'SIDE CHAIN' 54 15 ARG A 55 ? ? 0.250 'SIDE CHAIN' 55 15 ARG A 73 ? ? 0.311 'SIDE CHAIN' 56 15 ARG A 109 ? ? 0.205 'SIDE CHAIN' 57 16 ARG A 37 ? ? 0.269 'SIDE CHAIN' 58 16 ARG A 55 ? ? 0.082 'SIDE CHAIN' 59 16 ARG A 73 ? ? 0.263 'SIDE CHAIN' 60 16 ARG A 109 ? ? 0.314 'SIDE CHAIN' 61 17 ARG A 37 ? ? 0.300 'SIDE CHAIN' 62 17 ARG A 55 ? ? 0.317 'SIDE CHAIN' 63 17 ARG A 73 ? ? 0.170 'SIDE CHAIN' 64 17 ARG A 109 ? ? 0.245 'SIDE CHAIN' 65 18 ARG A 37 ? ? 0.291 'SIDE CHAIN' 66 18 ARG A 55 ? ? 0.184 'SIDE CHAIN' 67 18 ARG A 73 ? ? 0.314 'SIDE CHAIN' 68 18 ARG A 109 ? ? 0.317 'SIDE CHAIN' 69 19 ARG A 37 ? ? 0.290 'SIDE CHAIN' 70 19 ARG A 55 ? ? 0.273 'SIDE CHAIN' 71 19 ARG A 73 ? ? 0.241 'SIDE CHAIN' 72 19 ARG A 109 ? ? 0.262 'SIDE CHAIN' 73 20 ARG A 37 ? ? 0.307 'SIDE CHAIN' 74 20 ARG A 55 ? ? 0.315 'SIDE CHAIN' 75 20 ARG A 73 ? ? 0.226 'SIDE CHAIN' 76 20 ARG A 109 ? ? 0.292 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A HIS 20 ? A HIS 20 21 1 Y 1 A MET 21 ? A MET 21 22 1 Y 1 A GLY 22 ? A GLY 22 23 1 Y 1 A PRO 23 ? A PRO 23 24 1 Y 1 A PHE 24 ? A PHE 24 25 1 Y 1 A ARG 25 ? A ARG 25 26 1 Y 1 A ARG 26 ? A ARG 26 27 1 Y 1 A SER 27 ? A SER 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A SER 29 ? A SER 29 30 1 Y 1 A PHE 30 ? A PHE 30 31 1 Y 1 A PRO 31 ? A PRO 31 32 1 Y 1 A GLU 32 ? A GLU 32 33 1 Y 1 A ARG 33 ? A ARG 33 34 1 Y 1 A ARG 34 ? A ARG 34 35 2 Y 1 A MET 1 ? A MET 1 36 2 Y 1 A GLY 2 ? A GLY 2 37 2 Y 1 A SER 3 ? A SER 3 38 2 Y 1 A SER 4 ? A SER 4 39 2 Y 1 A HIS 5 ? A HIS 5 40 2 Y 1 A HIS 6 ? A HIS 6 41 2 Y 1 A HIS 7 ? A HIS 7 42 2 Y 1 A HIS 8 ? A HIS 8 43 2 Y 1 A HIS 9 ? A HIS 9 44 2 Y 1 A HIS 10 ? A HIS 10 45 2 Y 1 A SER 11 ? A SER 11 46 2 Y 1 A SER 12 ? A SER 12 47 2 Y 1 A GLY 13 ? A GLY 13 48 2 Y 1 A LEU 14 ? A LEU 14 49 2 Y 1 A VAL 15 ? A VAL 15 50 2 Y 1 A PRO 16 ? A PRO 16 51 2 Y 1 A ARG 17 ? A ARG 17 52 2 Y 1 A GLY 18 ? A GLY 18 53 2 Y 1 A SER 19 ? A SER 19 54 2 Y 1 A HIS 20 ? A HIS 20 55 2 Y 1 A MET 21 ? A MET 21 56 2 Y 1 A GLY 22 ? A GLY 22 57 2 Y 1 A PRO 23 ? A PRO 23 58 2 Y 1 A PHE 24 ? A PHE 24 59 2 Y 1 A ARG 25 ? A ARG 25 60 2 Y 1 A ARG 26 ? A ARG 26 61 2 Y 1 A SER 27 ? A SER 27 62 2 Y 1 A ASP 28 ? A ASP 28 63 2 Y 1 A SER 29 ? A SER 29 64 2 Y 1 A PHE 30 ? A PHE 30 65 2 Y 1 A PRO 31 ? A PRO 31 66 2 Y 1 A GLU 32 ? A GLU 32 67 2 Y 1 A ARG 33 ? A ARG 33 68 2 Y 1 A ARG 34 ? A ARG 34 69 3 Y 1 A MET 1 ? A MET 1 70 3 Y 1 A GLY 2 ? A GLY 2 71 3 Y 1 A SER 3 ? A SER 3 72 3 Y 1 A SER 4 ? A SER 4 73 3 Y 1 A HIS 5 ? A HIS 5 74 3 Y 1 A HIS 6 ? A HIS 6 75 3 Y 1 A HIS 7 ? A HIS 7 76 3 Y 1 A HIS 8 ? A HIS 8 77 3 Y 1 A HIS 9 ? A HIS 9 78 3 Y 1 A HIS 10 ? A HIS 10 79 3 Y 1 A SER 11 ? A SER 11 80 3 Y 1 A SER 12 ? A SER 12 81 3 Y 1 A GLY 13 ? A GLY 13 82 3 Y 1 A LEU 14 ? A LEU 14 83 3 Y 1 A VAL 15 ? A VAL 15 84 3 Y 1 A PRO 16 ? A PRO 16 85 3 Y 1 A ARG 17 ? A ARG 17 86 3 Y 1 A GLY 18 ? A GLY 18 87 3 Y 1 A SER 19 ? A SER 19 88 3 Y 1 A HIS 20 ? A HIS 20 89 3 Y 1 A MET 21 ? A MET 21 90 3 Y 1 A GLY 22 ? A GLY 22 91 3 Y 1 A PRO 23 ? A PRO 23 92 3 Y 1 A PHE 24 ? A PHE 24 93 3 Y 1 A ARG 25 ? A ARG 25 94 3 Y 1 A ARG 26 ? A ARG 26 95 3 Y 1 A SER 27 ? A SER 27 96 3 Y 1 A ASP 28 ? A ASP 28 97 3 Y 1 A SER 29 ? A SER 29 98 3 Y 1 A PHE 30 ? A PHE 30 99 3 Y 1 A PRO 31 ? A PRO 31 100 3 Y 1 A GLU 32 ? A GLU 32 101 3 Y 1 A ARG 33 ? A ARG 33 102 3 Y 1 A ARG 34 ? A ARG 34 103 4 Y 1 A MET 1 ? A MET 1 104 4 Y 1 A GLY 2 ? A GLY 2 105 4 Y 1 A SER 3 ? A SER 3 106 4 Y 1 A SER 4 ? A SER 4 107 4 Y 1 A HIS 5 ? A HIS 5 108 4 Y 1 A HIS 6 ? A HIS 6 109 4 Y 1 A HIS 7 ? A HIS 7 110 4 Y 1 A HIS 8 ? A HIS 8 111 4 Y 1 A HIS 9 ? A HIS 9 112 4 Y 1 A HIS 10 ? A HIS 10 113 4 Y 1 A SER 11 ? A SER 11 114 4 Y 1 A SER 12 ? A SER 12 115 4 Y 1 A GLY 13 ? A GLY 13 116 4 Y 1 A LEU 14 ? A LEU 14 117 4 Y 1 A VAL 15 ? A VAL 15 118 4 Y 1 A PRO 16 ? A PRO 16 119 4 Y 1 A ARG 17 ? A ARG 17 120 4 Y 1 A GLY 18 ? A GLY 18 121 4 Y 1 A SER 19 ? A SER 19 122 4 Y 1 A HIS 20 ? A HIS 20 123 4 Y 1 A MET 21 ? A MET 21 124 4 Y 1 A GLY 22 ? A GLY 22 125 4 Y 1 A PRO 23 ? A PRO 23 126 4 Y 1 A PHE 24 ? A PHE 24 127 4 Y 1 A ARG 25 ? A ARG 25 128 4 Y 1 A ARG 26 ? A ARG 26 129 4 Y 1 A SER 27 ? A SER 27 130 4 Y 1 A ASP 28 ? A ASP 28 131 4 Y 1 A SER 29 ? A SER 29 132 4 Y 1 A PHE 30 ? A PHE 30 133 4 Y 1 A PRO 31 ? A PRO 31 134 4 Y 1 A GLU 32 ? A GLU 32 135 4 Y 1 A ARG 33 ? A ARG 33 136 4 Y 1 A ARG 34 ? A ARG 34 137 5 Y 1 A MET 1 ? A MET 1 138 5 Y 1 A GLY 2 ? A GLY 2 139 5 Y 1 A SER 3 ? A SER 3 140 5 Y 1 A SER 4 ? A SER 4 141 5 Y 1 A HIS 5 ? A HIS 5 142 5 Y 1 A HIS 6 ? A HIS 6 143 5 Y 1 A HIS 7 ? A HIS 7 144 5 Y 1 A HIS 8 ? A HIS 8 145 5 Y 1 A HIS 9 ? A HIS 9 146 5 Y 1 A HIS 10 ? A HIS 10 147 5 Y 1 A SER 11 ? A SER 11 148 5 Y 1 A SER 12 ? A SER 12 149 5 Y 1 A GLY 13 ? A GLY 13 150 5 Y 1 A LEU 14 ? A LEU 14 151 5 Y 1 A VAL 15 ? A VAL 15 152 5 Y 1 A PRO 16 ? A PRO 16 153 5 Y 1 A ARG 17 ? A ARG 17 154 5 Y 1 A GLY 18 ? A GLY 18 155 5 Y 1 A SER 19 ? A SER 19 156 5 Y 1 A HIS 20 ? A HIS 20 157 5 Y 1 A MET 21 ? A MET 21 158 5 Y 1 A GLY 22 ? A GLY 22 159 5 Y 1 A PRO 23 ? A PRO 23 160 5 Y 1 A PHE 24 ? A PHE 24 161 5 Y 1 A ARG 25 ? A ARG 25 162 5 Y 1 A ARG 26 ? A ARG 26 163 5 Y 1 A SER 27 ? A SER 27 164 5 Y 1 A ASP 28 ? A ASP 28 165 5 Y 1 A SER 29 ? A SER 29 166 5 Y 1 A PHE 30 ? A PHE 30 167 5 Y 1 A PRO 31 ? A PRO 31 168 5 Y 1 A GLU 32 ? A GLU 32 169 5 Y 1 A ARG 33 ? A ARG 33 170 5 Y 1 A ARG 34 ? A ARG 34 171 6 Y 1 A MET 1 ? A MET 1 172 6 Y 1 A GLY 2 ? A GLY 2 173 6 Y 1 A SER 3 ? A SER 3 174 6 Y 1 A SER 4 ? A SER 4 175 6 Y 1 A HIS 5 ? A HIS 5 176 6 Y 1 A HIS 6 ? A HIS 6 177 6 Y 1 A HIS 7 ? A HIS 7 178 6 Y 1 A HIS 8 ? A HIS 8 179 6 Y 1 A HIS 9 ? A HIS 9 180 6 Y 1 A HIS 10 ? A HIS 10 181 6 Y 1 A SER 11 ? A SER 11 182 6 Y 1 A SER 12 ? A SER 12 183 6 Y 1 A GLY 13 ? A GLY 13 184 6 Y 1 A LEU 14 ? A LEU 14 185 6 Y 1 A VAL 15 ? A VAL 15 186 6 Y 1 A PRO 16 ? A PRO 16 187 6 Y 1 A ARG 17 ? A ARG 17 188 6 Y 1 A GLY 18 ? A GLY 18 189 6 Y 1 A SER 19 ? A SER 19 190 6 Y 1 A HIS 20 ? A HIS 20 191 6 Y 1 A MET 21 ? A MET 21 192 6 Y 1 A GLY 22 ? A GLY 22 193 6 Y 1 A PRO 23 ? A PRO 23 194 6 Y 1 A PHE 24 ? A PHE 24 195 6 Y 1 A ARG 25 ? A ARG 25 196 6 Y 1 A ARG 26 ? A ARG 26 197 6 Y 1 A SER 27 ? A SER 27 198 6 Y 1 A ASP 28 ? A ASP 28 199 6 Y 1 A SER 29 ? A SER 29 200 6 Y 1 A PHE 30 ? A PHE 30 201 6 Y 1 A PRO 31 ? A PRO 31 202 6 Y 1 A GLU 32 ? A GLU 32 203 6 Y 1 A ARG 33 ? A ARG 33 204 6 Y 1 A ARG 34 ? A ARG 34 205 7 Y 1 A MET 1 ? A MET 1 206 7 Y 1 A GLY 2 ? A GLY 2 207 7 Y 1 A SER 3 ? A SER 3 208 7 Y 1 A SER 4 ? A SER 4 209 7 Y 1 A HIS 5 ? A HIS 5 210 7 Y 1 A HIS 6 ? A HIS 6 211 7 Y 1 A HIS 7 ? A HIS 7 212 7 Y 1 A HIS 8 ? A HIS 8 213 7 Y 1 A HIS 9 ? A HIS 9 214 7 Y 1 A HIS 10 ? A HIS 10 215 7 Y 1 A SER 11 ? A SER 11 216 7 Y 1 A SER 12 ? A SER 12 217 7 Y 1 A GLY 13 ? A GLY 13 218 7 Y 1 A LEU 14 ? A LEU 14 219 7 Y 1 A VAL 15 ? A VAL 15 220 7 Y 1 A PRO 16 ? A PRO 16 221 7 Y 1 A ARG 17 ? A ARG 17 222 7 Y 1 A GLY 18 ? A GLY 18 223 7 Y 1 A SER 19 ? A SER 19 224 7 Y 1 A HIS 20 ? A HIS 20 225 7 Y 1 A MET 21 ? A MET 21 226 7 Y 1 A GLY 22 ? A GLY 22 227 7 Y 1 A PRO 23 ? A PRO 23 228 7 Y 1 A PHE 24 ? A PHE 24 229 7 Y 1 A ARG 25 ? A ARG 25 230 7 Y 1 A ARG 26 ? A ARG 26 231 7 Y 1 A SER 27 ? A SER 27 232 7 Y 1 A ASP 28 ? A ASP 28 233 7 Y 1 A SER 29 ? A SER 29 234 7 Y 1 A PHE 30 ? A PHE 30 235 7 Y 1 A PRO 31 ? A PRO 31 236 7 Y 1 A GLU 32 ? A GLU 32 237 7 Y 1 A ARG 33 ? A ARG 33 238 7 Y 1 A ARG 34 ? A ARG 34 239 8 Y 1 A MET 1 ? A MET 1 240 8 Y 1 A GLY 2 ? A GLY 2 241 8 Y 1 A SER 3 ? A SER 3 242 8 Y 1 A SER 4 ? A SER 4 243 8 Y 1 A HIS 5 ? A HIS 5 244 8 Y 1 A HIS 6 ? A HIS 6 245 8 Y 1 A HIS 7 ? A HIS 7 246 8 Y 1 A HIS 8 ? A HIS 8 247 8 Y 1 A HIS 9 ? A HIS 9 248 8 Y 1 A HIS 10 ? A HIS 10 249 8 Y 1 A SER 11 ? A SER 11 250 8 Y 1 A SER 12 ? A SER 12 251 8 Y 1 A GLY 13 ? A GLY 13 252 8 Y 1 A LEU 14 ? A LEU 14 253 8 Y 1 A VAL 15 ? A VAL 15 254 8 Y 1 A PRO 16 ? A PRO 16 255 8 Y 1 A ARG 17 ? A ARG 17 256 8 Y 1 A GLY 18 ? A GLY 18 257 8 Y 1 A SER 19 ? A SER 19 258 8 Y 1 A HIS 20 ? A HIS 20 259 8 Y 1 A MET 21 ? A MET 21 260 8 Y 1 A GLY 22 ? A GLY 22 261 8 Y 1 A PRO 23 ? A PRO 23 262 8 Y 1 A PHE 24 ? A PHE 24 263 8 Y 1 A ARG 25 ? A ARG 25 264 8 Y 1 A ARG 26 ? A ARG 26 265 8 Y 1 A SER 27 ? A SER 27 266 8 Y 1 A ASP 28 ? A ASP 28 267 8 Y 1 A SER 29 ? A SER 29 268 8 Y 1 A PHE 30 ? A PHE 30 269 8 Y 1 A PRO 31 ? A PRO 31 270 8 Y 1 A GLU 32 ? A GLU 32 271 8 Y 1 A ARG 33 ? A ARG 33 272 8 Y 1 A ARG 34 ? A ARG 34 273 9 Y 1 A MET 1 ? A MET 1 274 9 Y 1 A GLY 2 ? A GLY 2 275 9 Y 1 A SER 3 ? A SER 3 276 9 Y 1 A SER 4 ? A SER 4 277 9 Y 1 A HIS 5 ? A HIS 5 278 9 Y 1 A HIS 6 ? A HIS 6 279 9 Y 1 A HIS 7 ? A HIS 7 280 9 Y 1 A HIS 8 ? A HIS 8 281 9 Y 1 A HIS 9 ? A HIS 9 282 9 Y 1 A HIS 10 ? A HIS 10 283 9 Y 1 A SER 11 ? A SER 11 284 9 Y 1 A SER 12 ? A SER 12 285 9 Y 1 A GLY 13 ? A GLY 13 286 9 Y 1 A LEU 14 ? A LEU 14 287 9 Y 1 A VAL 15 ? A VAL 15 288 9 Y 1 A PRO 16 ? A PRO 16 289 9 Y 1 A ARG 17 ? A ARG 17 290 9 Y 1 A GLY 18 ? A GLY 18 291 9 Y 1 A SER 19 ? A SER 19 292 9 Y 1 A HIS 20 ? A HIS 20 293 9 Y 1 A MET 21 ? A MET 21 294 9 Y 1 A GLY 22 ? A GLY 22 295 9 Y 1 A PRO 23 ? A PRO 23 296 9 Y 1 A PHE 24 ? A PHE 24 297 9 Y 1 A ARG 25 ? A ARG 25 298 9 Y 1 A ARG 26 ? A ARG 26 299 9 Y 1 A SER 27 ? A SER 27 300 9 Y 1 A ASP 28 ? A ASP 28 301 9 Y 1 A SER 29 ? A SER 29 302 9 Y 1 A PHE 30 ? A PHE 30 303 9 Y 1 A PRO 31 ? A PRO 31 304 9 Y 1 A GLU 32 ? A GLU 32 305 9 Y 1 A ARG 33 ? A ARG 33 306 9 Y 1 A ARG 34 ? A ARG 34 307 10 Y 1 A MET 1 ? A MET 1 308 10 Y 1 A GLY 2 ? A GLY 2 309 10 Y 1 A SER 3 ? A SER 3 310 10 Y 1 A SER 4 ? A SER 4 311 10 Y 1 A HIS 5 ? A HIS 5 312 10 Y 1 A HIS 6 ? A HIS 6 313 10 Y 1 A HIS 7 ? A HIS 7 314 10 Y 1 A HIS 8 ? A HIS 8 315 10 Y 1 A HIS 9 ? A HIS 9 316 10 Y 1 A HIS 10 ? A HIS 10 317 10 Y 1 A SER 11 ? A SER 11 318 10 Y 1 A SER 12 ? A SER 12 319 10 Y 1 A GLY 13 ? A GLY 13 320 10 Y 1 A LEU 14 ? A LEU 14 321 10 Y 1 A VAL 15 ? A VAL 15 322 10 Y 1 A PRO 16 ? A PRO 16 323 10 Y 1 A ARG 17 ? A ARG 17 324 10 Y 1 A GLY 18 ? A GLY 18 325 10 Y 1 A SER 19 ? A SER 19 326 10 Y 1 A HIS 20 ? A HIS 20 327 10 Y 1 A MET 21 ? A MET 21 328 10 Y 1 A GLY 22 ? A GLY 22 329 10 Y 1 A PRO 23 ? A PRO 23 330 10 Y 1 A PHE 24 ? A PHE 24 331 10 Y 1 A ARG 25 ? A ARG 25 332 10 Y 1 A ARG 26 ? A ARG 26 333 10 Y 1 A SER 27 ? A SER 27 334 10 Y 1 A ASP 28 ? A ASP 28 335 10 Y 1 A SER 29 ? A SER 29 336 10 Y 1 A PHE 30 ? A PHE 30 337 10 Y 1 A PRO 31 ? A PRO 31 338 10 Y 1 A GLU 32 ? A GLU 32 339 10 Y 1 A ARG 33 ? A ARG 33 340 10 Y 1 A ARG 34 ? A ARG 34 341 11 Y 1 A MET 1 ? A MET 1 342 11 Y 1 A GLY 2 ? A GLY 2 343 11 Y 1 A SER 3 ? A SER 3 344 11 Y 1 A SER 4 ? A SER 4 345 11 Y 1 A HIS 5 ? A HIS 5 346 11 Y 1 A HIS 6 ? A HIS 6 347 11 Y 1 A HIS 7 ? A HIS 7 348 11 Y 1 A HIS 8 ? A HIS 8 349 11 Y 1 A HIS 9 ? A HIS 9 350 11 Y 1 A HIS 10 ? A HIS 10 351 11 Y 1 A SER 11 ? A SER 11 352 11 Y 1 A SER 12 ? A SER 12 353 11 Y 1 A GLY 13 ? A GLY 13 354 11 Y 1 A LEU 14 ? A LEU 14 355 11 Y 1 A VAL 15 ? A VAL 15 356 11 Y 1 A PRO 16 ? A PRO 16 357 11 Y 1 A ARG 17 ? A ARG 17 358 11 Y 1 A GLY 18 ? A GLY 18 359 11 Y 1 A SER 19 ? A SER 19 360 11 Y 1 A HIS 20 ? A HIS 20 361 11 Y 1 A MET 21 ? A MET 21 362 11 Y 1 A GLY 22 ? A GLY 22 363 11 Y 1 A PRO 23 ? A PRO 23 364 11 Y 1 A PHE 24 ? A PHE 24 365 11 Y 1 A ARG 25 ? A ARG 25 366 11 Y 1 A ARG 26 ? A ARG 26 367 11 Y 1 A SER 27 ? A SER 27 368 11 Y 1 A ASP 28 ? A ASP 28 369 11 Y 1 A SER 29 ? A SER 29 370 11 Y 1 A PHE 30 ? A PHE 30 371 11 Y 1 A PRO 31 ? A PRO 31 372 11 Y 1 A GLU 32 ? A GLU 32 373 11 Y 1 A ARG 33 ? A ARG 33 374 11 Y 1 A ARG 34 ? A ARG 34 375 12 Y 1 A MET 1 ? A MET 1 376 12 Y 1 A GLY 2 ? A GLY 2 377 12 Y 1 A SER 3 ? A SER 3 378 12 Y 1 A SER 4 ? A SER 4 379 12 Y 1 A HIS 5 ? A HIS 5 380 12 Y 1 A HIS 6 ? A HIS 6 381 12 Y 1 A HIS 7 ? A HIS 7 382 12 Y 1 A HIS 8 ? A HIS 8 383 12 Y 1 A HIS 9 ? A HIS 9 384 12 Y 1 A HIS 10 ? A HIS 10 385 12 Y 1 A SER 11 ? A SER 11 386 12 Y 1 A SER 12 ? A SER 12 387 12 Y 1 A GLY 13 ? A GLY 13 388 12 Y 1 A LEU 14 ? A LEU 14 389 12 Y 1 A VAL 15 ? A VAL 15 390 12 Y 1 A PRO 16 ? A PRO 16 391 12 Y 1 A ARG 17 ? A ARG 17 392 12 Y 1 A GLY 18 ? A GLY 18 393 12 Y 1 A SER 19 ? A SER 19 394 12 Y 1 A HIS 20 ? A HIS 20 395 12 Y 1 A MET 21 ? A MET 21 396 12 Y 1 A GLY 22 ? A GLY 22 397 12 Y 1 A PRO 23 ? A PRO 23 398 12 Y 1 A PHE 24 ? A PHE 24 399 12 Y 1 A ARG 25 ? A ARG 25 400 12 Y 1 A ARG 26 ? A ARG 26 401 12 Y 1 A SER 27 ? A SER 27 402 12 Y 1 A ASP 28 ? A ASP 28 403 12 Y 1 A SER 29 ? A SER 29 404 12 Y 1 A PHE 30 ? A PHE 30 405 12 Y 1 A PRO 31 ? A PRO 31 406 12 Y 1 A GLU 32 ? A GLU 32 407 12 Y 1 A ARG 33 ? A ARG 33 408 12 Y 1 A ARG 34 ? A ARG 34 409 13 Y 1 A MET 1 ? A MET 1 410 13 Y 1 A GLY 2 ? A GLY 2 411 13 Y 1 A SER 3 ? A SER 3 412 13 Y 1 A SER 4 ? A SER 4 413 13 Y 1 A HIS 5 ? A HIS 5 414 13 Y 1 A HIS 6 ? A HIS 6 415 13 Y 1 A HIS 7 ? A HIS 7 416 13 Y 1 A HIS 8 ? A HIS 8 417 13 Y 1 A HIS 9 ? A HIS 9 418 13 Y 1 A HIS 10 ? A HIS 10 419 13 Y 1 A SER 11 ? A SER 11 420 13 Y 1 A SER 12 ? A SER 12 421 13 Y 1 A GLY 13 ? A GLY 13 422 13 Y 1 A LEU 14 ? A LEU 14 423 13 Y 1 A VAL 15 ? A VAL 15 424 13 Y 1 A PRO 16 ? A PRO 16 425 13 Y 1 A ARG 17 ? A ARG 17 426 13 Y 1 A GLY 18 ? A GLY 18 427 13 Y 1 A SER 19 ? A SER 19 428 13 Y 1 A HIS 20 ? A HIS 20 429 13 Y 1 A MET 21 ? A MET 21 430 13 Y 1 A GLY 22 ? A GLY 22 431 13 Y 1 A PRO 23 ? A PRO 23 432 13 Y 1 A PHE 24 ? A PHE 24 433 13 Y 1 A ARG 25 ? A ARG 25 434 13 Y 1 A ARG 26 ? A ARG 26 435 13 Y 1 A SER 27 ? A SER 27 436 13 Y 1 A ASP 28 ? A ASP 28 437 13 Y 1 A SER 29 ? A SER 29 438 13 Y 1 A PHE 30 ? A PHE 30 439 13 Y 1 A PRO 31 ? A PRO 31 440 13 Y 1 A GLU 32 ? A GLU 32 441 13 Y 1 A ARG 33 ? A ARG 33 442 13 Y 1 A ARG 34 ? A ARG 34 443 14 Y 1 A MET 1 ? A MET 1 444 14 Y 1 A GLY 2 ? A GLY 2 445 14 Y 1 A SER 3 ? A SER 3 446 14 Y 1 A SER 4 ? A SER 4 447 14 Y 1 A HIS 5 ? A HIS 5 448 14 Y 1 A HIS 6 ? A HIS 6 449 14 Y 1 A HIS 7 ? A HIS 7 450 14 Y 1 A HIS 8 ? A HIS 8 451 14 Y 1 A HIS 9 ? A HIS 9 452 14 Y 1 A HIS 10 ? A HIS 10 453 14 Y 1 A SER 11 ? A SER 11 454 14 Y 1 A SER 12 ? A SER 12 455 14 Y 1 A GLY 13 ? A GLY 13 456 14 Y 1 A LEU 14 ? A LEU 14 457 14 Y 1 A VAL 15 ? A VAL 15 458 14 Y 1 A PRO 16 ? A PRO 16 459 14 Y 1 A ARG 17 ? A ARG 17 460 14 Y 1 A GLY 18 ? A GLY 18 461 14 Y 1 A SER 19 ? A SER 19 462 14 Y 1 A HIS 20 ? A HIS 20 463 14 Y 1 A MET 21 ? A MET 21 464 14 Y 1 A GLY 22 ? A GLY 22 465 14 Y 1 A PRO 23 ? A PRO 23 466 14 Y 1 A PHE 24 ? A PHE 24 467 14 Y 1 A ARG 25 ? A ARG 25 468 14 Y 1 A ARG 26 ? A ARG 26 469 14 Y 1 A SER 27 ? A SER 27 470 14 Y 1 A ASP 28 ? A ASP 28 471 14 Y 1 A SER 29 ? A SER 29 472 14 Y 1 A PHE 30 ? A PHE 30 473 14 Y 1 A PRO 31 ? A PRO 31 474 14 Y 1 A GLU 32 ? A GLU 32 475 14 Y 1 A ARG 33 ? A ARG 33 476 14 Y 1 A ARG 34 ? A ARG 34 477 15 Y 1 A MET 1 ? A MET 1 478 15 Y 1 A GLY 2 ? A GLY 2 479 15 Y 1 A SER 3 ? A SER 3 480 15 Y 1 A SER 4 ? A SER 4 481 15 Y 1 A HIS 5 ? A HIS 5 482 15 Y 1 A HIS 6 ? A HIS 6 483 15 Y 1 A HIS 7 ? A HIS 7 484 15 Y 1 A HIS 8 ? A HIS 8 485 15 Y 1 A HIS 9 ? A HIS 9 486 15 Y 1 A HIS 10 ? A HIS 10 487 15 Y 1 A SER 11 ? A SER 11 488 15 Y 1 A SER 12 ? A SER 12 489 15 Y 1 A GLY 13 ? A GLY 13 490 15 Y 1 A LEU 14 ? A LEU 14 491 15 Y 1 A VAL 15 ? A VAL 15 492 15 Y 1 A PRO 16 ? A PRO 16 493 15 Y 1 A ARG 17 ? A ARG 17 494 15 Y 1 A GLY 18 ? A GLY 18 495 15 Y 1 A SER 19 ? A SER 19 496 15 Y 1 A HIS 20 ? A HIS 20 497 15 Y 1 A MET 21 ? A MET 21 498 15 Y 1 A GLY 22 ? A GLY 22 499 15 Y 1 A PRO 23 ? A PRO 23 500 15 Y 1 A PHE 24 ? A PHE 24 501 15 Y 1 A ARG 25 ? A ARG 25 502 15 Y 1 A ARG 26 ? A ARG 26 503 15 Y 1 A SER 27 ? A SER 27 504 15 Y 1 A ASP 28 ? A ASP 28 505 15 Y 1 A SER 29 ? A SER 29 506 15 Y 1 A PHE 30 ? A PHE 30 507 15 Y 1 A PRO 31 ? A PRO 31 508 15 Y 1 A GLU 32 ? A GLU 32 509 15 Y 1 A ARG 33 ? A ARG 33 510 15 Y 1 A ARG 34 ? A ARG 34 511 16 Y 1 A MET 1 ? A MET 1 512 16 Y 1 A GLY 2 ? A GLY 2 513 16 Y 1 A SER 3 ? A SER 3 514 16 Y 1 A SER 4 ? A SER 4 515 16 Y 1 A HIS 5 ? A HIS 5 516 16 Y 1 A HIS 6 ? A HIS 6 517 16 Y 1 A HIS 7 ? A HIS 7 518 16 Y 1 A HIS 8 ? A HIS 8 519 16 Y 1 A HIS 9 ? A HIS 9 520 16 Y 1 A HIS 10 ? A HIS 10 521 16 Y 1 A SER 11 ? A SER 11 522 16 Y 1 A SER 12 ? A SER 12 523 16 Y 1 A GLY 13 ? A GLY 13 524 16 Y 1 A LEU 14 ? A LEU 14 525 16 Y 1 A VAL 15 ? A VAL 15 526 16 Y 1 A PRO 16 ? A PRO 16 527 16 Y 1 A ARG 17 ? A ARG 17 528 16 Y 1 A GLY 18 ? A GLY 18 529 16 Y 1 A SER 19 ? A SER 19 530 16 Y 1 A HIS 20 ? A HIS 20 531 16 Y 1 A MET 21 ? A MET 21 532 16 Y 1 A GLY 22 ? A GLY 22 533 16 Y 1 A PRO 23 ? A PRO 23 534 16 Y 1 A PHE 24 ? A PHE 24 535 16 Y 1 A ARG 25 ? A ARG 25 536 16 Y 1 A ARG 26 ? A ARG 26 537 16 Y 1 A SER 27 ? A SER 27 538 16 Y 1 A ASP 28 ? A ASP 28 539 16 Y 1 A SER 29 ? A SER 29 540 16 Y 1 A PHE 30 ? A PHE 30 541 16 Y 1 A PRO 31 ? A PRO 31 542 16 Y 1 A GLU 32 ? A GLU 32 543 16 Y 1 A ARG 33 ? A ARG 33 544 16 Y 1 A ARG 34 ? A ARG 34 545 17 Y 1 A MET 1 ? A MET 1 546 17 Y 1 A GLY 2 ? A GLY 2 547 17 Y 1 A SER 3 ? A SER 3 548 17 Y 1 A SER 4 ? A SER 4 549 17 Y 1 A HIS 5 ? A HIS 5 550 17 Y 1 A HIS 6 ? A HIS 6 551 17 Y 1 A HIS 7 ? A HIS 7 552 17 Y 1 A HIS 8 ? A HIS 8 553 17 Y 1 A HIS 9 ? A HIS 9 554 17 Y 1 A HIS 10 ? A HIS 10 555 17 Y 1 A SER 11 ? A SER 11 556 17 Y 1 A SER 12 ? A SER 12 557 17 Y 1 A GLY 13 ? A GLY 13 558 17 Y 1 A LEU 14 ? A LEU 14 559 17 Y 1 A VAL 15 ? A VAL 15 560 17 Y 1 A PRO 16 ? A PRO 16 561 17 Y 1 A ARG 17 ? A ARG 17 562 17 Y 1 A GLY 18 ? A GLY 18 563 17 Y 1 A SER 19 ? A SER 19 564 17 Y 1 A HIS 20 ? A HIS 20 565 17 Y 1 A MET 21 ? A MET 21 566 17 Y 1 A GLY 22 ? A GLY 22 567 17 Y 1 A PRO 23 ? A PRO 23 568 17 Y 1 A PHE 24 ? A PHE 24 569 17 Y 1 A ARG 25 ? A ARG 25 570 17 Y 1 A ARG 26 ? A ARG 26 571 17 Y 1 A SER 27 ? A SER 27 572 17 Y 1 A ASP 28 ? A ASP 28 573 17 Y 1 A SER 29 ? A SER 29 574 17 Y 1 A PHE 30 ? A PHE 30 575 17 Y 1 A PRO 31 ? A PRO 31 576 17 Y 1 A GLU 32 ? A GLU 32 577 17 Y 1 A ARG 33 ? A ARG 33 578 17 Y 1 A ARG 34 ? A ARG 34 579 18 Y 1 A MET 1 ? A MET 1 580 18 Y 1 A GLY 2 ? A GLY 2 581 18 Y 1 A SER 3 ? A SER 3 582 18 Y 1 A SER 4 ? A SER 4 583 18 Y 1 A HIS 5 ? A HIS 5 584 18 Y 1 A HIS 6 ? A HIS 6 585 18 Y 1 A HIS 7 ? A HIS 7 586 18 Y 1 A HIS 8 ? A HIS 8 587 18 Y 1 A HIS 9 ? A HIS 9 588 18 Y 1 A HIS 10 ? A HIS 10 589 18 Y 1 A SER 11 ? A SER 11 590 18 Y 1 A SER 12 ? A SER 12 591 18 Y 1 A GLY 13 ? A GLY 13 592 18 Y 1 A LEU 14 ? A LEU 14 593 18 Y 1 A VAL 15 ? A VAL 15 594 18 Y 1 A PRO 16 ? A PRO 16 595 18 Y 1 A ARG 17 ? A ARG 17 596 18 Y 1 A GLY 18 ? A GLY 18 597 18 Y 1 A SER 19 ? A SER 19 598 18 Y 1 A HIS 20 ? A HIS 20 599 18 Y 1 A MET 21 ? A MET 21 600 18 Y 1 A GLY 22 ? A GLY 22 601 18 Y 1 A PRO 23 ? A PRO 23 602 18 Y 1 A PHE 24 ? A PHE 24 603 18 Y 1 A ARG 25 ? A ARG 25 604 18 Y 1 A ARG 26 ? A ARG 26 605 18 Y 1 A SER 27 ? A SER 27 606 18 Y 1 A ASP 28 ? A ASP 28 607 18 Y 1 A SER 29 ? A SER 29 608 18 Y 1 A PHE 30 ? A PHE 30 609 18 Y 1 A PRO 31 ? A PRO 31 610 18 Y 1 A GLU 32 ? A GLU 32 611 18 Y 1 A ARG 33 ? A ARG 33 612 18 Y 1 A ARG 34 ? A ARG 34 613 19 Y 1 A MET 1 ? A MET 1 614 19 Y 1 A GLY 2 ? A GLY 2 615 19 Y 1 A SER 3 ? A SER 3 616 19 Y 1 A SER 4 ? A SER 4 617 19 Y 1 A HIS 5 ? A HIS 5 618 19 Y 1 A HIS 6 ? A HIS 6 619 19 Y 1 A HIS 7 ? A HIS 7 620 19 Y 1 A HIS 8 ? A HIS 8 621 19 Y 1 A HIS 9 ? A HIS 9 622 19 Y 1 A HIS 10 ? A HIS 10 623 19 Y 1 A SER 11 ? A SER 11 624 19 Y 1 A SER 12 ? A SER 12 625 19 Y 1 A GLY 13 ? A GLY 13 626 19 Y 1 A LEU 14 ? A LEU 14 627 19 Y 1 A VAL 15 ? A VAL 15 628 19 Y 1 A PRO 16 ? A PRO 16 629 19 Y 1 A ARG 17 ? A ARG 17 630 19 Y 1 A GLY 18 ? A GLY 18 631 19 Y 1 A SER 19 ? A SER 19 632 19 Y 1 A HIS 20 ? A HIS 20 633 19 Y 1 A MET 21 ? A MET 21 634 19 Y 1 A GLY 22 ? A GLY 22 635 19 Y 1 A PRO 23 ? A PRO 23 636 19 Y 1 A PHE 24 ? A PHE 24 637 19 Y 1 A ARG 25 ? A ARG 25 638 19 Y 1 A ARG 26 ? A ARG 26 639 19 Y 1 A SER 27 ? A SER 27 640 19 Y 1 A ASP 28 ? A ASP 28 641 19 Y 1 A SER 29 ? A SER 29 642 19 Y 1 A PHE 30 ? A PHE 30 643 19 Y 1 A PRO 31 ? A PRO 31 644 19 Y 1 A GLU 32 ? A GLU 32 645 19 Y 1 A ARG 33 ? A ARG 33 646 19 Y 1 A ARG 34 ? A ARG 34 647 20 Y 1 A MET 1 ? A MET 1 648 20 Y 1 A GLY 2 ? A GLY 2 649 20 Y 1 A SER 3 ? A SER 3 650 20 Y 1 A SER 4 ? A SER 4 651 20 Y 1 A HIS 5 ? A HIS 5 652 20 Y 1 A HIS 6 ? A HIS 6 653 20 Y 1 A HIS 7 ? A HIS 7 654 20 Y 1 A HIS 8 ? A HIS 8 655 20 Y 1 A HIS 9 ? A HIS 9 656 20 Y 1 A HIS 10 ? A HIS 10 657 20 Y 1 A SER 11 ? A SER 11 658 20 Y 1 A SER 12 ? A SER 12 659 20 Y 1 A GLY 13 ? A GLY 13 660 20 Y 1 A LEU 14 ? A LEU 14 661 20 Y 1 A VAL 15 ? A VAL 15 662 20 Y 1 A PRO 16 ? A PRO 16 663 20 Y 1 A ARG 17 ? A ARG 17 664 20 Y 1 A GLY 18 ? A GLY 18 665 20 Y 1 A SER 19 ? A SER 19 666 20 Y 1 A HIS 20 ? A HIS 20 667 20 Y 1 A MET 21 ? A MET 21 668 20 Y 1 A GLY 22 ? A GLY 22 669 20 Y 1 A PRO 23 ? A PRO 23 670 20 Y 1 A PHE 24 ? A PHE 24 671 20 Y 1 A ARG 25 ? A ARG 25 672 20 Y 1 A ARG 26 ? A ARG 26 673 20 Y 1 A SER 27 ? A SER 27 674 20 Y 1 A ASP 28 ? A ASP 28 675 20 Y 1 A SER 29 ? A SER 29 676 20 Y 1 A PHE 30 ? A PHE 30 677 20 Y 1 A PRO 31 ? A PRO 31 678 20 Y 1 A GLU 32 ? A GLU 32 679 20 Y 1 A ARG 33 ? A ARG 33 680 20 Y 1 A ARG 34 ? A ARG 34 #