data_2JXB # _entry.id 2JXB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JXB pdb_00002jxb 10.2210/pdb2jxb/pdb RCSB RCSB100407 ? ? WWPDB D_1000100407 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JXB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-11-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Takeuchi, K.' 1 'Yang, H.' 2 'Ng, E.' 3 'Park, S.' 4 'Sun, Z.J.' 5 'Reinherz, E.L.' 6 'Wagner, G.' 7 # _citation.id primary _citation.title 'Structural and functional evidence that Nck interaction with CD3epsilon regulates T-cell receptor activity.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 380 _citation.page_first 704 _citation.page_last 716 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18555270 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.05.037 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Takeuchi, K.' 1 ? primary 'Yang, H.' 2 ? primary 'Ng, E.' 3 ? primary 'Park, S.Y.' 4 ? primary 'Sun, Z.Y.' 5 ? primary 'Reinherz, E.L.' 6 ? primary 'Wagner, G.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'T-cell surface glycoprotein CD3 epsilon chain, Cytoplasmic protein NCK2' _entity.formula_weight 10267.655 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ;Fusion protein of T-cell surface glycoprotein CD3 epsilon chain cytoplasmic domain residues 177-188 and Cytoplasmic protein NCK2 first SH3 domain ; _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'T-cell surface antigen T3/Leu-4 epsilon chain, NCK adaptor protein 2, SH2/SH3 adaptor protein NCK-beta, Nck-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HMKERPPPVPNPDYNSLKKGSLVKNLHMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPS NYVERK ; _entity_poly.pdbx_seq_one_letter_code_can ;HMKERPPPVPNPDYNSLKKGSLVKNLHMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPS NYVERK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 LYS n 1 4 GLU n 1 5 ARG n 1 6 PRO n 1 7 PRO n 1 8 PRO n 1 9 VAL n 1 10 PRO n 1 11 ASN n 1 12 PRO n 1 13 ASP n 1 14 TYR n 1 15 ASN n 1 16 SER n 1 17 LEU n 1 18 LYS n 1 19 LYS n 1 20 GLY n 1 21 SER n 1 22 LEU n 1 23 VAL n 1 24 LYS n 1 25 ASN n 1 26 LEU n 1 27 HIS n 1 28 MET n 1 29 THR n 1 30 GLU n 1 31 GLU n 1 32 VAL n 1 33 ILE n 1 34 VAL n 1 35 ILE n 1 36 ALA n 1 37 LYS n 1 38 TRP n 1 39 ASP n 1 40 TYR n 1 41 THR n 1 42 ALA n 1 43 GLN n 1 44 GLN n 1 45 ASP n 1 46 GLN n 1 47 GLU n 1 48 LEU n 1 49 ASP n 1 50 ILE n 1 51 LYS n 1 52 LYS n 1 53 ASN n 1 54 GLU n 1 55 ARG n 1 56 LEU n 1 57 TRP n 1 58 LEU n 1 59 LEU n 1 60 ASP n 1 61 ASP n 1 62 SER n 1 63 LYS n 1 64 THR n 1 65 TRP n 1 66 TRP n 1 67 ARG n 1 68 VAL n 1 69 ARG n 1 70 ASN n 1 71 ALA n 1 72 ALA n 1 73 ASN n 1 74 ARG n 1 75 THR n 1 76 GLY n 1 77 TYR n 1 78 VAL n 1 79 PRO n 1 80 SER n 1 81 ASN n 1 82 TYR n 1 83 VAL n 1 84 GLU n 1 85 ARG n 1 86 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CD3E, NCK2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 1 HIS HIS A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 LYS 86 86 86 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JXB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JXB _struct.title 'Structure of CD3epsilon-Nck2 first SH3 domain complex' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JXB _struct_keywords.pdbx_keywords 'Signaling protein complex' _struct_keywords.text 'Nck, CD3epsilon, T-cell receptor, SH3 domain, Immunology, Cytoplasm, SH2 domain, Signaling protein complex' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP NCK2_HUMAN O43639 1 MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK 1 ? 2 UNP CD3E_HUMAN P07766 1 KERPPPVPNPDY 177 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2JXB A 28 ? 86 ? O43639 1 ? 59 ? 28 86 2 2 2JXB A 3 ? 14 ? P07766 177 ? 188 ? 3 14 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JXB HIS A 1 ? UNP O43639 ? ? 'expression tag' 1 1 1 2JXB MET A 2 ? UNP O43639 ? ? 'expression tag' 2 2 1 2JXB ASN A 15 ? UNP O43639 ? ? linker 15 3 1 2JXB SER A 16 ? UNP O43639 ? ? linker 16 4 1 2JXB LEU A 17 ? UNP O43639 ? ? linker 17 5 1 2JXB LYS A 18 ? UNP O43639 ? ? linker 18 6 1 2JXB LYS A 19 ? UNP O43639 ? ? linker 19 7 1 2JXB GLY A 20 ? UNP O43639 ? ? linker 20 8 1 2JXB SER A 21 ? UNP O43639 ? ? linker 21 9 1 2JXB LEU A 22 ? UNP O43639 ? ? linker 22 10 1 2JXB VAL A 23 ? UNP O43639 ? ? linker 23 11 1 2JXB LYS A 24 ? UNP O43639 ? ? linker 24 12 1 2JXB ASN A 25 ? UNP O43639 ? ? linker 25 13 1 2JXB LEU A 26 ? UNP O43639 ? ? linker 26 14 1 2JXB HIS A 27 ? UNP O43639 ? ? linker 27 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 81 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 83 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 81 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 83 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 32 ? ALA A 36 ? VAL A 32 ALA A 36 A 2 GLU A 54 ? ASP A 60 ? GLU A 54 ASP A 60 A 3 TRP A 65 ? ARG A 69 ? TRP A 65 ARG A 69 A 4 THR A 75 ? PRO A 79 ? THR A 75 PRO A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 36 ? N ALA A 36 O GLU A 54 ? O GLU A 54 A 2 3 N LEU A 59 ? N LEU A 59 O ARG A 67 ? O ARG A 67 A 3 4 N TRP A 66 ? N TRP A 66 O VAL A 78 ? O VAL A 78 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 10 ? ? -69.71 72.27 2 1 ASN A 11 ? ? 38.49 83.99 3 1 ASN A 15 ? ? -178.03 143.21 4 1 SER A 16 ? ? -160.05 -46.53 5 1 SER A 21 ? ? -112.44 -73.89 6 1 LEU A 22 ? ? 58.82 97.05 7 1 ASN A 25 ? ? -177.50 56.84 8 1 GLU A 30 ? ? -179.17 147.26 9 1 ALA A 42 ? ? -55.59 100.75 10 1 GLN A 44 ? ? -127.52 -169.92 11 1 LEU A 59 ? ? -96.62 -72.43 12 1 GLU A 84 ? ? -160.01 107.78 13 2 PRO A 8 ? ? -69.67 -179.85 14 2 PRO A 10 ? ? -69.76 72.07 15 2 ASN A 11 ? ? 38.38 83.44 16 2 ASP A 13 ? ? -159.03 54.42 17 2 GLU A 31 ? ? -154.15 77.08 18 2 LEU A 59 ? ? -99.66 -70.70 19 2 GLU A 84 ? ? -160.38 111.89 20 3 MET A 2 ? ? 56.34 79.28 21 3 PRO A 8 ? ? -69.73 -179.41 22 3 PRO A 10 ? ? -69.87 72.84 23 3 ASN A 11 ? ? 37.87 83.75 24 3 SER A 16 ? ? -156.49 -49.14 25 3 GLU A 30 ? ? -176.92 146.04 26 3 ALA A 42 ? ? -55.76 100.66 27 3 LEU A 59 ? ? -98.30 -71.71 28 3 GLU A 84 ? ? -160.42 112.50 29 4 GLU A 4 ? ? 62.42 -177.27 30 4 PRO A 10 ? ? -69.89 72.40 31 4 ASN A 11 ? ? 38.36 84.39 32 4 LYS A 18 ? ? 53.55 81.36 33 4 SER A 21 ? ? 52.62 75.24 34 4 VAL A 23 ? ? 60.66 93.37 35 4 ASN A 25 ? ? -162.76 -55.56 36 4 LEU A 26 ? ? 62.43 164.28 37 4 GLU A 30 ? ? -179.21 146.82 38 4 ALA A 42 ? ? -55.69 100.89 39 4 GLN A 44 ? ? -104.91 -169.64 40 4 LEU A 59 ? ? -99.88 -71.96 41 5 MET A 2 ? ? -140.45 -64.94 42 5 PRO A 10 ? ? -69.72 72.16 43 5 ASN A 11 ? ? 38.27 83.59 44 5 LEU A 17 ? ? -58.37 -178.76 45 5 SER A 21 ? ? 55.17 80.64 46 5 ASN A 25 ? ? 57.21 73.55 47 5 HIS A 27 ? ? 60.50 -179.48 48 5 MET A 28 ? ? 60.79 96.17 49 5 ALA A 42 ? ? -55.92 100.89 50 5 LEU A 59 ? ? -100.24 -71.96 51 5 GLU A 84 ? ? -160.33 110.69 52 6 MET A 2 ? ? 59.35 89.79 53 6 GLU A 4 ? ? 62.87 171.80 54 6 PRO A 8 ? ? -69.85 -179.67 55 6 PRO A 10 ? ? -69.75 72.71 56 6 ASN A 11 ? ? 38.67 83.28 57 6 ASN A 15 ? ? -177.51 -62.31 58 6 SER A 16 ? ? -179.09 -74.44 59 6 LEU A 17 ? ? -177.09 33.66 60 6 SER A 21 ? ? 61.21 72.80 61 6 VAL A 23 ? ? -176.39 142.23 62 6 LYS A 24 ? ? 61.75 98.76 63 6 ASN A 25 ? ? -178.35 98.12 64 6 GLU A 30 ? ? 65.49 146.02 65 6 LEU A 59 ? ? -99.12 -72.96 66 6 GLU A 84 ? ? -160.71 118.54 67 7 MET A 2 ? ? -172.72 135.02 68 7 PRO A 8 ? ? -69.80 -178.36 69 7 PRO A 10 ? ? -69.81 72.72 70 7 ASN A 11 ? ? 38.00 84.03 71 7 ASN A 15 ? ? -58.43 172.58 72 7 MET A 28 ? ? 59.49 96.58 73 7 ALA A 42 ? ? -55.72 100.46 74 7 LYS A 52 ? ? -42.91 154.04 75 7 LEU A 59 ? ? -95.16 -72.31 76 7 GLU A 84 ? ? -160.50 118.39 77 8 PRO A 8 ? ? -69.83 -177.17 78 8 PRO A 10 ? ? -69.72 72.92 79 8 ASN A 11 ? ? 37.75 84.12 80 8 ASN A 15 ? ? 62.63 103.75 81 8 LYS A 19 ? ? 61.04 75.01 82 8 SER A 21 ? ? 69.25 -75.71 83 8 LEU A 22 ? ? 56.68 91.64 84 8 MET A 28 ? ? -147.96 59.30 85 8 GLU A 30 ? ? 65.45 145.76 86 8 GLU A 31 ? ? -153.60 83.87 87 8 LEU A 59 ? ? -101.72 -71.29 88 8 GLU A 84 ? ? -160.26 106.73 89 9 PRO A 8 ? ? -69.72 -178.75 90 9 PRO A 10 ? ? -69.80 74.92 91 9 ASN A 11 ? ? 38.56 81.73 92 9 SER A 16 ? ? -155.59 41.48 93 9 LEU A 17 ? ? -175.37 139.68 94 9 LEU A 22 ? ? -177.25 -179.74 95 9 LEU A 26 ? ? 62.09 172.87 96 9 HIS A 27 ? ? -159.30 39.35 97 9 ALA A 42 ? ? -55.55 100.13 98 9 LEU A 59 ? ? -102.23 -68.05 99 9 ASP A 61 ? ? -119.84 76.43 100 10 GLU A 4 ? ? -170.57 -171.44 101 10 PRO A 8 ? ? -69.62 -179.70 102 10 PRO A 10 ? ? -69.80 73.07 103 10 ASN A 11 ? ? 37.77 83.98 104 10 SER A 16 ? ? -163.73 -50.33 105 10 THR A 29 ? ? -150.16 30.88 106 10 GLU A 30 ? ? -178.45 146.48 107 10 ALA A 42 ? ? -55.61 100.52 108 10 LYS A 52 ? ? -43.75 155.79 109 10 LEU A 59 ? ? -98.19 -71.44 110 11 PRO A 8 ? ? -69.73 -178.83 111 11 PRO A 10 ? ? -69.76 72.71 112 11 ASN A 11 ? ? 38.04 82.48 113 11 ASN A 15 ? ? 63.16 105.17 114 11 LEU A 17 ? ? -172.02 86.55 115 11 LYS A 19 ? ? -168.19 66.64 116 11 LEU A 26 ? ? 52.00 81.36 117 11 LEU A 59 ? ? -99.80 -72.46 118 12 MET A 2 ? ? -150.90 41.38 119 12 GLU A 4 ? ? 62.45 -176.24 120 12 PRO A 10 ? ? -69.74 72.96 121 12 ASN A 11 ? ? 37.50 84.25 122 12 LYS A 18 ? ? 62.69 176.93 123 12 LYS A 19 ? ? -136.58 -55.90 124 12 LEU A 22 ? ? 59.92 -176.85 125 12 ASN A 25 ? ? -63.17 -178.96 126 12 THR A 29 ? ? 56.24 -172.41 127 12 ALA A 42 ? ? -55.84 100.70 128 12 LEU A 59 ? ? -101.60 -68.88 129 12 GLU A 84 ? ? -160.59 113.52 130 13 GLU A 4 ? ? 54.14 -173.58 131 13 PRO A 8 ? ? -69.73 -176.22 132 13 PRO A 10 ? ? -69.88 72.55 133 13 ASN A 11 ? ? 38.20 83.84 134 13 LEU A 17 ? ? 56.10 -175.05 135 13 LYS A 18 ? ? 54.61 -170.04 136 13 SER A 21 ? ? -141.46 -73.94 137 13 VAL A 23 ? ? -175.76 141.96 138 13 LYS A 24 ? ? -147.25 -57.21 139 13 ASN A 25 ? ? 61.71 167.05 140 13 MET A 28 ? ? -121.62 -75.18 141 13 THR A 29 ? ? 59.97 176.38 142 13 GLU A 30 ? ? 65.54 145.50 143 13 ALA A 42 ? ? -55.59 100.71 144 13 LEU A 59 ? ? -98.14 -72.04 145 13 GLU A 84 ? ? -160.30 115.85 146 14 GLU A 4 ? ? 62.80 -177.23 147 14 PRO A 10 ? ? -69.77 72.99 148 14 ASN A 11 ? ? 37.80 83.92 149 14 SER A 16 ? ? -179.89 -33.98 150 14 LEU A 17 ? ? -146.97 28.80 151 14 LYS A 18 ? ? -105.25 -72.21 152 14 LYS A 19 ? ? 52.19 81.95 153 14 LEU A 59 ? ? -94.68 -72.89 154 15 GLU A 4 ? ? 63.19 -178.70 155 15 PRO A 10 ? ? -69.73 73.06 156 15 ASN A 11 ? ? 37.84 83.73 157 15 LEU A 17 ? ? -141.02 32.04 158 15 SER A 21 ? ? -169.06 -73.96 159 15 LEU A 22 ? ? 62.59 167.87 160 15 LYS A 24 ? ? -178.65 -67.91 161 15 ASN A 25 ? ? -179.23 -172.48 162 15 ALA A 42 ? ? -55.97 100.95 163 15 LEU A 59 ? ? -98.30 -71.86 164 15 GLU A 84 ? ? -160.53 112.04 165 16 ARG A 5 ? ? 62.04 159.61 166 16 PRO A 10 ? ? -69.72 72.07 167 16 ASN A 11 ? ? 38.29 83.60 168 16 LEU A 22 ? ? -56.97 177.57 169 16 HIS A 27 ? ? 59.54 -174.47 170 16 ALA A 42 ? ? -55.73 100.66 171 16 LEU A 59 ? ? -102.15 -70.51 172 17 MET A 2 ? ? 63.19 -179.32 173 17 PRO A 10 ? ? -69.75 73.13 174 17 ASN A 11 ? ? 37.46 84.16 175 17 LEU A 17 ? ? 70.38 -72.28 176 17 VAL A 23 ? ? -172.99 146.56 177 17 LYS A 24 ? ? -170.06 -54.93 178 17 ASN A 25 ? ? 69.20 -75.80 179 17 LEU A 26 ? ? 59.22 85.04 180 17 HIS A 27 ? ? -147.60 -48.85 181 17 GLU A 30 ? ? -179.22 146.95 182 17 LYS A 52 ? ? -42.35 153.08 183 17 LEU A 59 ? ? -96.49 -71.67 184 17 GLU A 84 ? ? -160.77 117.36 185 18 PRO A 8 ? ? -69.65 -173.09 186 18 PRO A 10 ? ? -69.75 73.44 187 18 ASN A 11 ? ? 38.34 82.95 188 18 SER A 21 ? ? -132.42 -70.46 189 18 LEU A 26 ? ? -69.73 -173.49 190 18 HIS A 27 ? ? -100.93 -71.61 191 18 MET A 28 ? ? -165.39 108.00 192 18 THR A 29 ? ? -158.74 37.73 193 18 GLU A 30 ? ? -177.42 146.50 194 18 ALA A 42 ? ? -55.66 104.89 195 18 LEU A 59 ? ? -96.46 -73.11 196 18 GLU A 84 ? ? -160.29 113.06 197 19 PRO A 10 ? ? -69.85 72.96 198 19 ASN A 11 ? ? 38.09 83.32 199 19 SER A 16 ? ? -163.75 34.90 200 19 LEU A 17 ? ? 56.33 90.26 201 19 SER A 21 ? ? -157.43 -57.00 202 19 LEU A 22 ? ? -58.12 109.21 203 19 LYS A 24 ? ? 62.24 166.83 204 19 ASN A 25 ? ? 62.93 175.03 205 19 HIS A 27 ? ? -142.72 -66.23 206 19 MET A 28 ? ? 63.21 162.00 207 19 THR A 29 ? ? 178.52 -32.63 208 19 ALA A 42 ? ? -55.48 108.39 209 19 LEU A 59 ? ? -95.52 -71.88 210 19 GLU A 84 ? ? -160.18 115.07 211 20 MET A 2 ? ? 61.88 178.90 212 20 GLU A 4 ? ? 61.94 101.88 213 20 ARG A 5 ? ? 65.99 136.32 214 20 PRO A 10 ? ? -69.75 72.36 215 20 ASN A 11 ? ? 38.35 84.14 216 20 SER A 16 ? ? 62.50 179.87 217 20 LEU A 22 ? ? 62.53 173.19 218 20 LYS A 24 ? ? -145.46 -52.68 219 20 ASN A 25 ? ? 54.39 89.48 220 20 HIS A 27 ? ? -149.58 35.80 221 20 THR A 29 ? ? -151.63 30.10 222 20 GLN A 44 ? ? -102.90 -169.75 223 20 ASN A 53 ? ? 63.75 67.84 224 20 LEU A 59 ? ? -99.98 -70.03 225 20 ASP A 61 ? ? -119.75 72.52 226 20 GLU A 84 ? ? -161.49 119.41 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JXB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JXB _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '2 mM [U-13C; U-15N] entity, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component entity _pdbx_nmr_exptl_sample.concentration 2 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCA' 1 2 1 '3D HNCACB' 1 3 1 '3D HN(CO)CA' 1 4 1 '3D H(CCO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2JXB _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 1 'Bruker Biospin' collection XwinNMR ? 2 'Keller and Wuthrich' 'data analysis' CARA ? 3 'Keller and Wuthrich' 'peak picking' CARA ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TRP N N N N 281 TRP CA C N S 282 TRP C C N N 283 TRP O O N N 284 TRP CB C N N 285 TRP CG C Y N 286 TRP CD1 C Y N 287 TRP CD2 C Y N 288 TRP NE1 N Y N 289 TRP CE2 C Y N 290 TRP CE3 C Y N 291 TRP CZ2 C Y N 292 TRP CZ3 C Y N 293 TRP CH2 C Y N 294 TRP OXT O N N 295 TRP H H N N 296 TRP H2 H N N 297 TRP HA H N N 298 TRP HB2 H N N 299 TRP HB3 H N N 300 TRP HD1 H N N 301 TRP HE1 H N N 302 TRP HE3 H N N 303 TRP HZ2 H N N 304 TRP HZ3 H N N 305 TRP HH2 H N N 306 TRP HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PRO N CA sing N N 222 PRO N CD sing N N 223 PRO N H sing N N 224 PRO CA C sing N N 225 PRO CA CB sing N N 226 PRO CA HA sing N N 227 PRO C O doub N N 228 PRO C OXT sing N N 229 PRO CB CG sing N N 230 PRO CB HB2 sing N N 231 PRO CB HB3 sing N N 232 PRO CG CD sing N N 233 PRO CG HG2 sing N N 234 PRO CG HG3 sing N N 235 PRO CD HD2 sing N N 236 PRO CD HD3 sing N N 237 PRO OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TRP N CA sing N N 268 TRP N H sing N N 269 TRP N H2 sing N N 270 TRP CA C sing N N 271 TRP CA CB sing N N 272 TRP CA HA sing N N 273 TRP C O doub N N 274 TRP C OXT sing N N 275 TRP CB CG sing N N 276 TRP CB HB2 sing N N 277 TRP CB HB3 sing N N 278 TRP CG CD1 doub Y N 279 TRP CG CD2 sing Y N 280 TRP CD1 NE1 sing Y N 281 TRP CD1 HD1 sing N N 282 TRP CD2 CE2 doub Y N 283 TRP CD2 CE3 sing Y N 284 TRP NE1 CE2 sing Y N 285 TRP NE1 HE1 sing N N 286 TRP CE2 CZ2 sing Y N 287 TRP CE3 CZ3 doub Y N 288 TRP CE3 HE3 sing N N 289 TRP CZ2 CH2 doub Y N 290 TRP CZ2 HZ2 sing N N 291 TRP CZ3 CH2 sing Y N 292 TRP CZ3 HZ3 sing N N 293 TRP CH2 HH2 sing N N 294 TRP OXT HXT sing N N 295 TYR N CA sing N N 296 TYR N H sing N N 297 TYR N H2 sing N N 298 TYR CA C sing N N 299 TYR CA CB sing N N 300 TYR CA HA sing N N 301 TYR C O doub N N 302 TYR C OXT sing N N 303 TYR CB CG sing N N 304 TYR CB HB2 sing N N 305 TYR CB HB3 sing N N 306 TYR CG CD1 doub Y N 307 TYR CG CD2 sing Y N 308 TYR CD1 CE1 sing Y N 309 TYR CD1 HD1 sing N N 310 TYR CD2 CE2 doub Y N 311 TYR CD2 HD2 sing N N 312 TYR CE1 CZ doub Y N 313 TYR CE1 HE1 sing N N 314 TYR CE2 CZ sing Y N 315 TYR CE2 HE2 sing N N 316 TYR CZ OH sing N N 317 TYR OH HH sing N N 318 TYR OXT HXT sing N N 319 VAL N CA sing N N 320 VAL N H sing N N 321 VAL N H2 sing N N 322 VAL CA C sing N N 323 VAL CA CB sing N N 324 VAL CA HA sing N N 325 VAL C O doub N N 326 VAL C OXT sing N N 327 VAL CB CG1 sing N N 328 VAL CB CG2 sing N N 329 VAL CB HB sing N N 330 VAL CG1 HG11 sing N N 331 VAL CG1 HG12 sing N N 332 VAL CG1 HG13 sing N N 333 VAL CG2 HG21 sing N N 334 VAL CG2 HG22 sing N N 335 VAL CG2 HG23 sing N N 336 VAL OXT HXT sing N N 337 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2JXB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_