data_2JXZ # _entry.id 2JXZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JXZ pdb_00002jxz 10.2210/pdb2jxz/pdb RCSB RCSB100430 ? ? WWPDB D_1000100430 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-11-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' pdbx_nmr_software 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_ref_seq_dif 9 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 3 'Structure model' '_struct_ref_seq_dif.details' 16 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JXZ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-12-03 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Andreotti, G.' 1 'Vitale, R.' 2 'Avidan-Shpalter, C.' 3 'Amodeo, P.' 4 'Gazit, E.' 5 'Motta, A.' 6 # _citation.id primary _citation.title ;Converting the highly amyloidogenic human calcitonin into a powerful fibril inhibitor by 3D structure homology with a non-amyloidogenic analogue ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 286 _citation.page_first 2707 _citation.page_last 2718 _citation.year 2011 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21078667 _citation.pdbx_database_id_DOI 10.1074/jbc.M110.182014 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Andreotti, G.' 1 ? primary 'Vitale, R.M.' 2 ? primary 'Avidan-Shpalter, C.' 3 ? primary 'Amodeo, P.' 4 ? primary 'Gazit, E.' 5 ? primary 'Motta, A.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Calcitonin _entity.formula_weight 3455.895 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'Y12L, N17H, A26N, I27T, A31T' _entity.pdbx_fragment 'calcitonin, UNP residues 85-116' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'CGNLSTCMLGTLTQDFHKFHTFPQTNTGVGTP(NH2)' _entity_poly.pdbx_seq_one_letter_code_can CGNLSTCMLGTLTQDFHKFHTFPQTNTGVGTPX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 GLY n 1 3 ASN n 1 4 LEU n 1 5 SER n 1 6 THR n 1 7 CYS n 1 8 MET n 1 9 LEU n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 THR n 1 14 GLN n 1 15 ASP n 1 16 PHE n 1 17 HIS n 1 18 LYS n 1 19 PHE n 1 20 HIS n 1 21 THR n 1 22 PHE n 1 23 PRO n 1 24 GLN n 1 25 THR n 1 26 ASN n 1 27 THR n 1 28 GLY n 1 29 VAL n 1 30 GLY n 1 31 THR n 1 32 PRO n 1 33 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'PEPTIDE SYNTHESIS' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 NH2 33 33 33 NH2 NH2 A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JXZ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JXZ _struct.title 'Solution Conformation of A Non-Amyloidogenic Analogue of Human Calcitonin in Sodium Dodecyl Sulfate Micelles' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JXZ _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'A-HELIX, Amidation, Cleavage on pair of basic residues, Hormone, Secreted' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALC_HUMAN _struct_ref.pdbx_db_accession P01258 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP _struct_ref.pdbx_align_begin 85 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JXZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01258 _struct_ref_seq.db_align_beg 85 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JXZ LEU A 12 ? UNP P01258 TYR 96 'engineered mutation' 12 1 1 2JXZ HIS A 17 ? UNP P01258 ASN 101 'engineered mutation' 17 2 1 2JXZ ASN A 26 ? UNP P01258 ALA 110 'engineered mutation' 26 3 1 2JXZ THR A 27 ? UNP P01258 ILE 111 'engineered mutation' 27 4 1 2JXZ THR A 31 ? UNP P01258 ALA 115 'engineered mutation' 31 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 3 ? PHE A 22 ? ASN A 3 PHE A 22 1 ? 20 HELX_P HELX_P2 2 GLN A 24 ? GLY A 28 ? GLN A 24 GLY A 28 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 7 SG ? ? A CYS 1 A CYS 7 1_555 ? ? ? ? ? ? ? 2.034 ? ? covale1 covale both ? A PRO 32 C ? ? ? 1_555 A NH2 33 N ? ? A PRO 32 A NH2 33 1_555 ? ? ? ? ? ? ? 1.327 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NH2 A 33 ? PRO A 32 ? NH2 A 33 ? 1_555 PRO A 32 ? 1_555 . . PRO 13 NH2 None 'Terminal amidation' 2 CYS A 1 ? CYS A 7 ? CYS A 1 ? 1_555 CYS A 7 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 33 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 33' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 PHE A 22 ? PHE A 22 . ? 1_555 ? 2 AC1 3 GLN A 24 ? GLN A 24 . ? 1_555 ? 3 AC1 3 THR A 31 ? THR A 31 . ? 1_555 ? # _pdbx_entry_details.entry_id 2JXZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CA A CYS 1 ? ? CB A CYS 1 ? ? SG A CYS 1 ? ? 124.29 114.20 10.09 1.10 N 2 3 CB A PHE 16 ? ? CG A PHE 16 ? ? CD2 A PHE 16 ? ? 116.58 120.80 -4.22 0.70 N 3 4 CB A PHE 16 ? ? CG A PHE 16 ? ? CD2 A PHE 16 ? ? 116.54 120.80 -4.26 0.70 N 4 10 CB A PHE 16 ? ? CG A PHE 16 ? ? CD2 A PHE 16 ? ? 116.60 120.80 -4.20 0.70 N 5 12 CB A PHE 16 ? ? CG A PHE 16 ? ? CD2 A PHE 16 ? ? 116.44 120.80 -4.36 0.70 N 6 14 CB A PHE 16 ? ? CG A PHE 16 ? ? CD2 A PHE 16 ? ? 116.57 120.80 -4.23 0.70 N 7 15 CB A PHE 16 ? ? CG A PHE 16 ? ? CD2 A PHE 16 ? ? 116.57 120.80 -4.23 0.70 N 8 17 CB A PHE 16 ? ? CG A PHE 16 ? ? CD2 A PHE 16 ? ? 116.54 120.80 -4.26 0.70 N 9 19 CB A PHE 16 ? ? CG A PHE 16 ? ? CD2 A PHE 16 ? ? 116.55 120.80 -4.25 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 25 ? ? -27.21 -27.48 2 2 THR A 25 ? ? 42.88 -6.90 3 2 VAL A 29 ? ? -140.91 -44.23 4 3 THR A 25 ? ? 44.75 -7.85 5 3 THR A 27 ? ? -163.78 114.36 6 4 ASN A 26 ? ? -60.57 40.75 7 4 VAL A 29 ? ? -48.83 -18.16 8 5 VAL A 29 ? ? -156.64 -47.00 9 6 PHE A 22 ? ? -176.06 114.32 10 6 VAL A 29 ? ? -142.78 -26.12 11 7 VAL A 29 ? ? -149.18 -52.58 12 7 THR A 31 ? ? -49.06 162.72 13 8 THR A 25 ? ? -140.79 -101.74 14 8 THR A 27 ? ? -139.15 -42.90 15 9 ASN A 26 ? ? -61.21 43.72 16 10 PHE A 22 ? ? -151.09 85.91 17 10 THR A 25 ? ? -134.76 -40.30 18 10 THR A 27 ? ? -166.15 110.31 19 10 THR A 31 ? ? 42.49 70.89 20 11 PHE A 22 ? ? -155.17 87.59 21 11 THR A 27 ? ? -161.78 112.00 22 12 THR A 25 ? ? 44.61 -9.40 23 12 THR A 27 ? ? -163.39 111.66 24 13 THR A 27 ? ? -146.89 -1.89 25 13 VAL A 29 ? ? -45.81 -13.11 26 13 THR A 31 ? ? 40.38 74.98 27 14 VAL A 29 ? ? -156.48 -48.84 28 15 THR A 25 ? ? -39.48 -30.35 29 15 VAL A 29 ? ? -165.13 -28.52 30 16 THR A 25 ? ? -67.82 2.26 31 16 VAL A 29 ? ? -162.37 -38.01 32 17 VAL A 29 ? ? -166.48 -44.00 33 18 THR A 25 ? ? 149.92 129.14 34 18 VAL A 29 ? ? -143.29 -64.97 35 19 VAL A 29 ? ? -160.65 -43.82 36 20 GLN A 24 ? ? -164.77 -40.51 37 20 THR A 27 ? ? -40.19 -18.59 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 15 GLY A 30 ? ? THR A 31 ? ? -145.85 2 16 GLY A 30 ? ? THR A 31 ? ? -147.55 3 18 GLY A 30 ? ? THR A 31 ? ? -149.61 4 20 GLN A 24 ? ? THR A 25 ? ? -138.78 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'Restraint violations, Amber energy, Procheck parameters' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JXZ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JXZ _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1.5 mM phCalcitonin, 159 mM [U-2H] SDS, 95% H20, 5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H20, 5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id phCalcitonin 1.5 mM ? 1 SDS 159 mM '[U-2H]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 1 2 1 '2D TOCSY' # _pdbx_nmr_refine.entry_id 2JXZ _pdbx_nmr_refine.method 'Restrained Simulated Annealing/Energy Minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, Simmerling, Wang, Duke, Luo, Koll' 'structure solution' Amber 6.0 1 'Case, Darden, Cheatham, Simmerling, Wang, Duke, Luo, Koll' refinement Amber 6.0 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLY N N N N 81 GLY CA C N N 82 GLY C C N N 83 GLY O O N N 84 GLY OXT O N N 85 GLY H H N N 86 GLY H2 H N N 87 GLY HA2 H N N 88 GLY HA3 H N N 89 GLY HXT H N N 90 HIS N N N N 91 HIS CA C N S 92 HIS C C N N 93 HIS O O N N 94 HIS CB C N N 95 HIS CG C Y N 96 HIS ND1 N Y N 97 HIS CD2 C Y N 98 HIS CE1 C Y N 99 HIS NE2 N Y N 100 HIS OXT O N N 101 HIS H H N N 102 HIS H2 H N N 103 HIS HA H N N 104 HIS HB2 H N N 105 HIS HB3 H N N 106 HIS HD1 H N N 107 HIS HD2 H N N 108 HIS HE1 H N N 109 HIS HE2 H N N 110 HIS HXT H N N 111 ILE N N N N 112 ILE CA C N S 113 ILE C C N N 114 ILE O O N N 115 ILE CB C N S 116 ILE CG1 C N N 117 ILE CG2 C N N 118 ILE CD1 C N N 119 ILE OXT O N N 120 ILE H H N N 121 ILE H2 H N N 122 ILE HA H N N 123 ILE HB H N N 124 ILE HG12 H N N 125 ILE HG13 H N N 126 ILE HG21 H N N 127 ILE HG22 H N N 128 ILE HG23 H N N 129 ILE HD11 H N N 130 ILE HD12 H N N 131 ILE HD13 H N N 132 ILE HXT H N N 133 LEU N N N N 134 LEU CA C N S 135 LEU C C N N 136 LEU O O N N 137 LEU CB C N N 138 LEU CG C N N 139 LEU CD1 C N N 140 LEU CD2 C N N 141 LEU OXT O N N 142 LEU H H N N 143 LEU H2 H N N 144 LEU HA H N N 145 LEU HB2 H N N 146 LEU HB3 H N N 147 LEU HG H N N 148 LEU HD11 H N N 149 LEU HD12 H N N 150 LEU HD13 H N N 151 LEU HD21 H N N 152 LEU HD22 H N N 153 LEU HD23 H N N 154 LEU HXT H N N 155 LYS N N N N 156 LYS CA C N S 157 LYS C C N N 158 LYS O O N N 159 LYS CB C N N 160 LYS CG C N N 161 LYS CD C N N 162 LYS CE C N N 163 LYS NZ N N N 164 LYS OXT O N N 165 LYS H H N N 166 LYS H2 H N N 167 LYS HA H N N 168 LYS HB2 H N N 169 LYS HB3 H N N 170 LYS HG2 H N N 171 LYS HG3 H N N 172 LYS HD2 H N N 173 LYS HD3 H N N 174 LYS HE2 H N N 175 LYS HE3 H N N 176 LYS HZ1 H N N 177 LYS HZ2 H N N 178 LYS HZ3 H N N 179 LYS HXT H N N 180 MET N N N N 181 MET CA C N S 182 MET C C N N 183 MET O O N N 184 MET CB C N N 185 MET CG C N N 186 MET SD S N N 187 MET CE C N N 188 MET OXT O N N 189 MET H H N N 190 MET H2 H N N 191 MET HA H N N 192 MET HB2 H N N 193 MET HB3 H N N 194 MET HG2 H N N 195 MET HG3 H N N 196 MET HE1 H N N 197 MET HE2 H N N 198 MET HE3 H N N 199 MET HXT H N N 200 NH2 N N N N 201 NH2 HN1 H N N 202 NH2 HN2 H N N 203 PHE N N N N 204 PHE CA C N S 205 PHE C C N N 206 PHE O O N N 207 PHE CB C N N 208 PHE CG C Y N 209 PHE CD1 C Y N 210 PHE CD2 C Y N 211 PHE CE1 C Y N 212 PHE CE2 C Y N 213 PHE CZ C Y N 214 PHE OXT O N N 215 PHE H H N N 216 PHE H2 H N N 217 PHE HA H N N 218 PHE HB2 H N N 219 PHE HB3 H N N 220 PHE HD1 H N N 221 PHE HD2 H N N 222 PHE HE1 H N N 223 PHE HE2 H N N 224 PHE HZ H N N 225 PHE HXT H N N 226 PRO N N N N 227 PRO CA C N S 228 PRO C C N N 229 PRO O O N N 230 PRO CB C N N 231 PRO CG C N N 232 PRO CD C N N 233 PRO OXT O N N 234 PRO H H N N 235 PRO HA H N N 236 PRO HB2 H N N 237 PRO HB3 H N N 238 PRO HG2 H N N 239 PRO HG3 H N N 240 PRO HD2 H N N 241 PRO HD3 H N N 242 PRO HXT H N N 243 SER N N N N 244 SER CA C N S 245 SER C C N N 246 SER O O N N 247 SER CB C N N 248 SER OG O N N 249 SER OXT O N N 250 SER H H N N 251 SER H2 H N N 252 SER HA H N N 253 SER HB2 H N N 254 SER HB3 H N N 255 SER HG H N N 256 SER HXT H N N 257 THR N N N N 258 THR CA C N S 259 THR C C N N 260 THR O O N N 261 THR CB C N R 262 THR OG1 O N N 263 THR CG2 C N N 264 THR OXT O N N 265 THR H H N N 266 THR H2 H N N 267 THR HA H N N 268 THR HB H N N 269 THR HG1 H N N 270 THR HG21 H N N 271 THR HG22 H N N 272 THR HG23 H N N 273 THR HXT H N N 274 TYR N N N N 275 TYR CA C N S 276 TYR C C N N 277 TYR O O N N 278 TYR CB C N N 279 TYR CG C Y N 280 TYR CD1 C Y N 281 TYR CD2 C Y N 282 TYR CE1 C Y N 283 TYR CE2 C Y N 284 TYR CZ C Y N 285 TYR OH O N N 286 TYR OXT O N N 287 TYR H H N N 288 TYR H2 H N N 289 TYR HA H N N 290 TYR HB2 H N N 291 TYR HB3 H N N 292 TYR HD1 H N N 293 TYR HD2 H N N 294 TYR HE1 H N N 295 TYR HE2 H N N 296 TYR HH H N N 297 TYR HXT H N N 298 VAL N N N N 299 VAL CA C N S 300 VAL C C N N 301 VAL O O N N 302 VAL CB C N N 303 VAL CG1 C N N 304 VAL CG2 C N N 305 VAL OXT O N N 306 VAL H H N N 307 VAL H2 H N N 308 VAL HA H N N 309 VAL HB H N N 310 VAL HG11 H N N 311 VAL HG12 H N N 312 VAL HG13 H N N 313 VAL HG21 H N N 314 VAL HG22 H N N 315 VAL HG23 H N N 316 VAL HXT H N N 317 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLY N CA sing N N 76 GLY N H sing N N 77 GLY N H2 sing N N 78 GLY CA C sing N N 79 GLY CA HA2 sing N N 80 GLY CA HA3 sing N N 81 GLY C O doub N N 82 GLY C OXT sing N N 83 GLY OXT HXT sing N N 84 HIS N CA sing N N 85 HIS N H sing N N 86 HIS N H2 sing N N 87 HIS CA C sing N N 88 HIS CA CB sing N N 89 HIS CA HA sing N N 90 HIS C O doub N N 91 HIS C OXT sing N N 92 HIS CB CG sing N N 93 HIS CB HB2 sing N N 94 HIS CB HB3 sing N N 95 HIS CG ND1 sing Y N 96 HIS CG CD2 doub Y N 97 HIS ND1 CE1 doub Y N 98 HIS ND1 HD1 sing N N 99 HIS CD2 NE2 sing Y N 100 HIS CD2 HD2 sing N N 101 HIS CE1 NE2 sing Y N 102 HIS CE1 HE1 sing N N 103 HIS NE2 HE2 sing N N 104 HIS OXT HXT sing N N 105 ILE N CA sing N N 106 ILE N H sing N N 107 ILE N H2 sing N N 108 ILE CA C sing N N 109 ILE CA CB sing N N 110 ILE CA HA sing N N 111 ILE C O doub N N 112 ILE C OXT sing N N 113 ILE CB CG1 sing N N 114 ILE CB CG2 sing N N 115 ILE CB HB sing N N 116 ILE CG1 CD1 sing N N 117 ILE CG1 HG12 sing N N 118 ILE CG1 HG13 sing N N 119 ILE CG2 HG21 sing N N 120 ILE CG2 HG22 sing N N 121 ILE CG2 HG23 sing N N 122 ILE CD1 HD11 sing N N 123 ILE CD1 HD12 sing N N 124 ILE CD1 HD13 sing N N 125 ILE OXT HXT sing N N 126 LEU N CA sing N N 127 LEU N H sing N N 128 LEU N H2 sing N N 129 LEU CA C sing N N 130 LEU CA CB sing N N 131 LEU CA HA sing N N 132 LEU C O doub N N 133 LEU C OXT sing N N 134 LEU CB CG sing N N 135 LEU CB HB2 sing N N 136 LEU CB HB3 sing N N 137 LEU CG CD1 sing N N 138 LEU CG CD2 sing N N 139 LEU CG HG sing N N 140 LEU CD1 HD11 sing N N 141 LEU CD1 HD12 sing N N 142 LEU CD1 HD13 sing N N 143 LEU CD2 HD21 sing N N 144 LEU CD2 HD22 sing N N 145 LEU CD2 HD23 sing N N 146 LEU OXT HXT sing N N 147 LYS N CA sing N N 148 LYS N H sing N N 149 LYS N H2 sing N N 150 LYS CA C sing N N 151 LYS CA CB sing N N 152 LYS CA HA sing N N 153 LYS C O doub N N 154 LYS C OXT sing N N 155 LYS CB CG sing N N 156 LYS CB HB2 sing N N 157 LYS CB HB3 sing N N 158 LYS CG CD sing N N 159 LYS CG HG2 sing N N 160 LYS CG HG3 sing N N 161 LYS CD CE sing N N 162 LYS CD HD2 sing N N 163 LYS CD HD3 sing N N 164 LYS CE NZ sing N N 165 LYS CE HE2 sing N N 166 LYS CE HE3 sing N N 167 LYS NZ HZ1 sing N N 168 LYS NZ HZ2 sing N N 169 LYS NZ HZ3 sing N N 170 LYS OXT HXT sing N N 171 MET N CA sing N N 172 MET N H sing N N 173 MET N H2 sing N N 174 MET CA C sing N N 175 MET CA CB sing N N 176 MET CA HA sing N N 177 MET C O doub N N 178 MET C OXT sing N N 179 MET CB CG sing N N 180 MET CB HB2 sing N N 181 MET CB HB3 sing N N 182 MET CG SD sing N N 183 MET CG HG2 sing N N 184 MET CG HG3 sing N N 185 MET SD CE sing N N 186 MET CE HE1 sing N N 187 MET CE HE2 sing N N 188 MET CE HE3 sing N N 189 MET OXT HXT sing N N 190 NH2 N HN1 sing N N 191 NH2 N HN2 sing N N 192 PHE N CA sing N N 193 PHE N H sing N N 194 PHE N H2 sing N N 195 PHE CA C sing N N 196 PHE CA CB sing N N 197 PHE CA HA sing N N 198 PHE C O doub N N 199 PHE C OXT sing N N 200 PHE CB CG sing N N 201 PHE CB HB2 sing N N 202 PHE CB HB3 sing N N 203 PHE CG CD1 doub Y N 204 PHE CG CD2 sing Y N 205 PHE CD1 CE1 sing Y N 206 PHE CD1 HD1 sing N N 207 PHE CD2 CE2 doub Y N 208 PHE CD2 HD2 sing N N 209 PHE CE1 CZ doub Y N 210 PHE CE1 HE1 sing N N 211 PHE CE2 CZ sing Y N 212 PHE CE2 HE2 sing N N 213 PHE CZ HZ sing N N 214 PHE OXT HXT sing N N 215 PRO N CA sing N N 216 PRO N CD sing N N 217 PRO N H sing N N 218 PRO CA C sing N N 219 PRO CA CB sing N N 220 PRO CA HA sing N N 221 PRO C O doub N N 222 PRO C OXT sing N N 223 PRO CB CG sing N N 224 PRO CB HB2 sing N N 225 PRO CB HB3 sing N N 226 PRO CG CD sing N N 227 PRO CG HG2 sing N N 228 PRO CG HG3 sing N N 229 PRO CD HD2 sing N N 230 PRO CD HD3 sing N N 231 PRO OXT HXT sing N N 232 SER N CA sing N N 233 SER N H sing N N 234 SER N H2 sing N N 235 SER CA C sing N N 236 SER CA CB sing N N 237 SER CA HA sing N N 238 SER C O doub N N 239 SER C OXT sing N N 240 SER CB OG sing N N 241 SER CB HB2 sing N N 242 SER CB HB3 sing N N 243 SER OG HG sing N N 244 SER OXT HXT sing N N 245 THR N CA sing N N 246 THR N H sing N N 247 THR N H2 sing N N 248 THR CA C sing N N 249 THR CA CB sing N N 250 THR CA HA sing N N 251 THR C O doub N N 252 THR C OXT sing N N 253 THR CB OG1 sing N N 254 THR CB CG2 sing N N 255 THR CB HB sing N N 256 THR OG1 HG1 sing N N 257 THR CG2 HG21 sing N N 258 THR CG2 HG22 sing N N 259 THR CG2 HG23 sing N N 260 THR OXT HXT sing N N 261 TYR N CA sing N N 262 TYR N H sing N N 263 TYR N H2 sing N N 264 TYR CA C sing N N 265 TYR CA CB sing N N 266 TYR CA HA sing N N 267 TYR C O doub N N 268 TYR C OXT sing N N 269 TYR CB CG sing N N 270 TYR CB HB2 sing N N 271 TYR CB HB3 sing N N 272 TYR CG CD1 doub Y N 273 TYR CG CD2 sing Y N 274 TYR CD1 CE1 sing Y N 275 TYR CD1 HD1 sing N N 276 TYR CD2 CE2 doub Y N 277 TYR CD2 HD2 sing N N 278 TYR CE1 CZ doub Y N 279 TYR CE1 HE1 sing N N 280 TYR CE2 CZ sing Y N 281 TYR CE2 HE2 sing N N 282 TYR CZ OH sing N N 283 TYR OH HH sing N N 284 TYR OXT HXT sing N N 285 VAL N CA sing N N 286 VAL N H sing N N 287 VAL N H2 sing N N 288 VAL CA C sing N N 289 VAL CA CB sing N N 290 VAL CA HA sing N N 291 VAL C O doub N N 292 VAL C OXT sing N N 293 VAL CB CG1 sing N N 294 VAL CB CG2 sing N N 295 VAL CB HB sing N N 296 VAL CG1 HG11 sing N N 297 VAL CG1 HG12 sing N N 298 VAL CG1 HG13 sing N N 299 VAL CG2 HG21 sing N N 300 VAL CG2 HG22 sing N N 301 VAL CG2 HG23 sing N N 302 VAL OXT HXT sing N N 303 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2JXZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #