data_2JY5 # _entry.id 2JY5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JY5 pdb_00002jy5 10.2210/pdb2jy5/pdb RCSB RCSB100436 ? ? WWPDB D_1000100436 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-03-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JY5 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-12-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2JY6 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, D.' 1 'Raasi, S.' 2 'Fushman, D.' 3 # _citation.id primary _citation.title ;Affinity makes the difference: nonselective interaction of the UBA domain of Ubiquilin-1 with monomeric ubiquitin and polyubiquitin chains ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 377 _citation.page_first 162 _citation.page_last 180 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18241885 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2007.12.029 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, D.' 1 ? primary 'Raasi, S.' 2 ? primary 'Fushman, D.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Ubiquilin-1 _entity.formula_weight 5634.231 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UBA domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein linking IAP with cytoskeleton 1, PLIC-1, hPLIC- 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS _entity_poly.pdbx_seq_one_letter_code_can GSPEFQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 GLU n 1 5 PHE n 1 6 GLN n 1 7 ASN n 1 8 PRO n 1 9 GLU n 1 10 VAL n 1 11 ARG n 1 12 PHE n 1 13 GLN n 1 14 GLN n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 GLN n 1 19 LEU n 1 20 SER n 1 21 ALA n 1 22 MET n 1 23 GLY n 1 24 PHE n 1 25 LEU n 1 26 ASN n 1 27 ARG n 1 28 GLU n 1 29 ALA n 1 30 ASN n 1 31 LEU n 1 32 GLN n 1 33 ALA n 1 34 LEU n 1 35 ILE n 1 36 ALA n 1 37 THR n 1 38 GLY n 1 39 GLY n 1 40 ASP n 1 41 ILE n 1 42 ASN n 1 43 ALA n 1 44 ALA n 1 45 ILE n 1 46 GLU n 1 47 ARG n 1 48 LEU n 1 49 LEU n 1 50 GLY n 1 51 SER n 1 52 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'UBQLN1, DA41, PLIC1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pGEX _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description pGEX-4T1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 536 536 GLY GLY A . n A 1 2 SER 2 537 537 SER SER A . n A 1 3 PRO 3 538 538 PRO PRO A . n A 1 4 GLU 4 539 539 GLU GLU A . n A 1 5 PHE 5 540 540 PHE PHE A . n A 1 6 GLN 6 541 541 GLN GLN A . n A 1 7 ASN 7 542 542 ASN ASN A . n A 1 8 PRO 8 543 543 PRO PRO A . n A 1 9 GLU 9 544 544 GLU GLU A . n A 1 10 VAL 10 545 545 VAL VAL A . n A 1 11 ARG 11 546 546 ARG ARG A . n A 1 12 PHE 12 547 547 PHE PHE A . n A 1 13 GLN 13 548 548 GLN GLN A . n A 1 14 GLN 14 549 549 GLN GLN A . n A 1 15 GLN 15 550 550 GLN GLN A . n A 1 16 LEU 16 551 551 LEU LEU A . n A 1 17 GLU 17 552 552 GLU GLU A . n A 1 18 GLN 18 553 553 GLN GLN A . n A 1 19 LEU 19 554 554 LEU LEU A . n A 1 20 SER 20 555 555 SER SER A . n A 1 21 ALA 21 556 556 ALA ALA A . n A 1 22 MET 22 557 557 MET MET A . n A 1 23 GLY 23 558 558 GLY GLY A . n A 1 24 PHE 24 559 559 PHE PHE A . n A 1 25 LEU 25 560 560 LEU LEU A . n A 1 26 ASN 26 561 561 ASN ASN A . n A 1 27 ARG 27 562 562 ARG ARG A . n A 1 28 GLU 28 563 563 GLU GLU A . n A 1 29 ALA 29 564 564 ALA ALA A . n A 1 30 ASN 30 565 565 ASN ASN A . n A 1 31 LEU 31 566 566 LEU LEU A . n A 1 32 GLN 32 567 567 GLN GLN A . n A 1 33 ALA 33 568 568 ALA ALA A . n A 1 34 LEU 34 569 569 LEU LEU A . n A 1 35 ILE 35 570 570 ILE ILE A . n A 1 36 ALA 36 571 571 ALA ALA A . n A 1 37 THR 37 572 572 THR THR A . n A 1 38 GLY 38 573 573 GLY GLY A . n A 1 39 GLY 39 574 574 GLY GLY A . n A 1 40 ASP 40 575 575 ASP ASP A . n A 1 41 ILE 41 576 576 ILE ILE A . n A 1 42 ASN 42 577 577 ASN ASN A . n A 1 43 ALA 43 578 578 ALA ALA A . n A 1 44 ALA 44 579 579 ALA ALA A . n A 1 45 ILE 45 580 580 ILE ILE A . n A 1 46 GLU 46 581 581 GLU GLU A . n A 1 47 ARG 47 582 582 ARG ARG A . n A 1 48 LEU 48 583 583 LEU LEU A . n A 1 49 LEU 49 584 584 LEU LEU A . n A 1 50 GLY 50 585 585 GLY GLY A . n A 1 51 SER 51 586 586 SER SER A . n A 1 52 SER 52 587 587 SER SER A . n # _cell.entry_id 2JY5 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JY5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JY5 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JY5 _struct.title 'NMR structure of Ubiquilin 1 UBA domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JY5 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'UBA, Ubiquilin, Alternative splicing, Cytoplasm, Nucleus, Phosphoprotein, Proteasome, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBQL1_HUMAN _struct_ref.pdbx_db_accession Q9UMX0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGS _struct_ref.pdbx_align_begin 541 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JY5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 51 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UMX0 _struct_ref_seq.db_align_beg 541 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 586 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 541 _struct_ref_seq.pdbx_auth_seq_align_end 586 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JY5 GLY A 1 ? UNP Q9UMX0 ? ? 'expression tag' 536 1 1 2JY5 SER A 2 ? UNP Q9UMX0 ? ? 'expression tag' 537 2 1 2JY5 PRO A 3 ? UNP Q9UMX0 ? ? 'expression tag' 538 3 1 2JY5 GLU A 4 ? UNP Q9UMX0 ? ? 'expression tag' 539 4 1 2JY5 PHE A 5 ? UNP Q9UMX0 ? ? 'expression tag' 540 5 1 2JY5 SER A 52 ? UNP Q9UMX0 ? ? 'expression tag' 587 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 12 ? ALA A 21 ? PHE A 547 ALA A 556 1 ? 10 HELX_P HELX_P2 2 ASN A 26 ? GLY A 38 ? ASN A 561 GLY A 573 1 ? 13 HELX_P HELX_P3 3 ASP A 40 ? LEU A 49 ? ASP A 575 LEU A 584 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 3 CE1 A PHE 547 ? ? CZ A PHE 547 ? ? 1.483 1.369 0.114 0.019 N 2 10 CE1 A PHE 547 ? ? CZ A PHE 547 ? ? 1.526 1.369 0.157 0.019 N 3 10 CZ A PHE 547 ? ? CE2 A PHE 547 ? ? 1.243 1.369 -0.126 0.019 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 537 ? ? -158.24 72.34 2 1 GLN A 548 ? ? 29.89 -78.70 3 1 SER A 586 ? ? -147.62 -61.54 4 2 PRO A 538 ? ? -72.09 -147.86 5 2 GLU A 539 ? ? 62.92 -99.51 6 2 ARG A 546 ? ? 70.37 36.07 7 2 GLN A 548 ? ? 29.42 -79.16 8 2 PHE A 559 ? ? 29.85 112.01 9 2 SER A 586 ? ? -143.48 52.70 10 3 SER A 537 ? ? -157.37 -53.50 11 3 GLU A 539 ? ? -131.14 -46.01 12 3 ARG A 546 ? ? 72.58 38.01 13 3 GLN A 548 ? ? 28.16 -81.60 14 3 ASN A 561 ? ? -108.98 79.56 15 3 SER A 586 ? ? 42.20 70.61 16 4 GLN A 548 ? ? 28.29 -76.17 17 4 PHE A 559 ? ? 28.39 108.35 18 4 SER A 586 ? ? 59.06 -173.89 19 5 GLU A 539 ? ? 55.77 105.89 20 5 PHE A 540 ? ? -93.71 -76.04 21 5 PHE A 547 ? ? 22.95 37.37 22 5 GLN A 548 ? ? 28.31 -86.24 23 5 ARG A 562 ? ? -57.94 -70.97 24 6 GLU A 539 ? ? -154.30 -52.19 25 6 PRO A 543 ? ? -38.82 -12.19 26 6 ARG A 546 ? ? 76.73 42.80 27 6 GLN A 548 ? ? 30.92 -84.48 28 6 MET A 557 ? ? -81.53 31.34 29 6 ASN A 561 ? ? -51.36 95.36 30 6 ASP A 575 ? ? -65.16 90.60 31 7 SER A 537 ? ? -158.88 81.61 32 7 ARG A 546 ? ? 78.14 33.77 33 7 GLN A 548 ? ? 29.15 -82.31 34 7 SER A 586 ? ? -153.53 -0.77 35 8 SER A 537 ? ? 57.03 70.33 36 8 ARG A 546 ? ? 73.09 40.26 37 8 GLN A 548 ? ? 30.40 -83.32 38 9 PRO A 538 ? ? -60.99 95.09 39 9 GLU A 539 ? ? -50.31 78.16 40 9 GLN A 548 ? ? 34.69 -79.60 41 10 SER A 537 ? ? -162.47 -52.71 42 10 GLU A 539 ? ? 49.82 104.16 43 10 PRO A 543 ? ? -48.27 -13.46 44 10 PHE A 547 ? ? 32.40 37.85 45 10 GLN A 548 ? ? 23.87 -84.12 46 10 SER A 586 ? ? -77.26 -157.48 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 PHE A 547 ? ? 0.068 'SIDE CHAIN' 2 8 PHE A 547 ? ? 0.062 'SIDE CHAIN' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JY5 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JY5 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '20 mM sodium phosphate, 0.05 % sodium azide, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '20 mM sodium phosphate, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 20 mM ? 1 'sodium azide' 0.05 % ? 1 'sodium phosphate' 20 mM ? 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 '20 mM' 6.8 ambient ? 296 K 2 '20 mM' 6.8 ambient ? 306 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '3D 15N-SEPARATED TOCSY' 1 5 2 '2D 1H-15N IPAP HSQC' 1 6 2 HMQC-J 1 7 2 '15N R1 AND R2' 1 8 2 '15N{1H} NOE' # _pdbx_nmr_refine.entry_id 2JY5 _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 1 ;Linge, O'Donoghue and Nilges ; 'geometry optimization' ARIA ? 2 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 MET N N N N 167 MET CA C N S 168 MET C C N N 169 MET O O N N 170 MET CB C N N 171 MET CG C N N 172 MET SD S N N 173 MET CE C N N 174 MET OXT O N N 175 MET H H N N 176 MET H2 H N N 177 MET HA H N N 178 MET HB2 H N N 179 MET HB3 H N N 180 MET HG2 H N N 181 MET HG3 H N N 182 MET HE1 H N N 183 MET HE2 H N N 184 MET HE3 H N N 185 MET HXT H N N 186 PHE N N N N 187 PHE CA C N S 188 PHE C C N N 189 PHE O O N N 190 PHE CB C N N 191 PHE CG C Y N 192 PHE CD1 C Y N 193 PHE CD2 C Y N 194 PHE CE1 C Y N 195 PHE CE2 C Y N 196 PHE CZ C Y N 197 PHE OXT O N N 198 PHE H H N N 199 PHE H2 H N N 200 PHE HA H N N 201 PHE HB2 H N N 202 PHE HB3 H N N 203 PHE HD1 H N N 204 PHE HD2 H N N 205 PHE HE1 H N N 206 PHE HE2 H N N 207 PHE HZ H N N 208 PHE HXT H N N 209 PRO N N N N 210 PRO CA C N S 211 PRO C C N N 212 PRO O O N N 213 PRO CB C N N 214 PRO CG C N N 215 PRO CD C N N 216 PRO OXT O N N 217 PRO H H N N 218 PRO HA H N N 219 PRO HB2 H N N 220 PRO HB3 H N N 221 PRO HG2 H N N 222 PRO HG3 H N N 223 PRO HD2 H N N 224 PRO HD3 H N N 225 PRO HXT H N N 226 SER N N N N 227 SER CA C N S 228 SER C C N N 229 SER O O N N 230 SER CB C N N 231 SER OG O N N 232 SER OXT O N N 233 SER H H N N 234 SER H2 H N N 235 SER HA H N N 236 SER HB2 H N N 237 SER HB3 H N N 238 SER HG H N N 239 SER HXT H N N 240 THR N N N N 241 THR CA C N S 242 THR C C N N 243 THR O O N N 244 THR CB C N R 245 THR OG1 O N N 246 THR CG2 C N N 247 THR OXT O N N 248 THR H H N N 249 THR H2 H N N 250 THR HA H N N 251 THR HB H N N 252 THR HG1 H N N 253 THR HG21 H N N 254 THR HG22 H N N 255 THR HG23 H N N 256 THR HXT H N N 257 VAL N N N N 258 VAL CA C N S 259 VAL C C N N 260 VAL O O N N 261 VAL CB C N N 262 VAL CG1 C N N 263 VAL CG2 C N N 264 VAL OXT O N N 265 VAL H H N N 266 VAL H2 H N N 267 VAL HA H N N 268 VAL HB H N N 269 VAL HG11 H N N 270 VAL HG12 H N N 271 VAL HG13 H N N 272 VAL HG21 H N N 273 VAL HG22 H N N 274 VAL HG23 H N N 275 VAL HXT H N N 276 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 MET N CA sing N N 158 MET N H sing N N 159 MET N H2 sing N N 160 MET CA C sing N N 161 MET CA CB sing N N 162 MET CA HA sing N N 163 MET C O doub N N 164 MET C OXT sing N N 165 MET CB CG sing N N 166 MET CB HB2 sing N N 167 MET CB HB3 sing N N 168 MET CG SD sing N N 169 MET CG HG2 sing N N 170 MET CG HG3 sing N N 171 MET SD CE sing N N 172 MET CE HE1 sing N N 173 MET CE HE2 sing N N 174 MET CE HE3 sing N N 175 MET OXT HXT sing N N 176 PHE N CA sing N N 177 PHE N H sing N N 178 PHE N H2 sing N N 179 PHE CA C sing N N 180 PHE CA CB sing N N 181 PHE CA HA sing N N 182 PHE C O doub N N 183 PHE C OXT sing N N 184 PHE CB CG sing N N 185 PHE CB HB2 sing N N 186 PHE CB HB3 sing N N 187 PHE CG CD1 doub Y N 188 PHE CG CD2 sing Y N 189 PHE CD1 CE1 sing Y N 190 PHE CD1 HD1 sing N N 191 PHE CD2 CE2 doub Y N 192 PHE CD2 HD2 sing N N 193 PHE CE1 CZ doub Y N 194 PHE CE1 HE1 sing N N 195 PHE CE2 CZ sing Y N 196 PHE CE2 HE2 sing N N 197 PHE CZ HZ sing N N 198 PHE OXT HXT sing N N 199 PRO N CA sing N N 200 PRO N CD sing N N 201 PRO N H sing N N 202 PRO CA C sing N N 203 PRO CA CB sing N N 204 PRO CA HA sing N N 205 PRO C O doub N N 206 PRO C OXT sing N N 207 PRO CB CG sing N N 208 PRO CB HB2 sing N N 209 PRO CB HB3 sing N N 210 PRO CG CD sing N N 211 PRO CG HG2 sing N N 212 PRO CG HG3 sing N N 213 PRO CD HD2 sing N N 214 PRO CD HD3 sing N N 215 PRO OXT HXT sing N N 216 SER N CA sing N N 217 SER N H sing N N 218 SER N H2 sing N N 219 SER CA C sing N N 220 SER CA CB sing N N 221 SER CA HA sing N N 222 SER C O doub N N 223 SER C OXT sing N N 224 SER CB OG sing N N 225 SER CB HB2 sing N N 226 SER CB HB3 sing N N 227 SER OG HG sing N N 228 SER OXT HXT sing N N 229 THR N CA sing N N 230 THR N H sing N N 231 THR N H2 sing N N 232 THR CA C sing N N 233 THR CA CB sing N N 234 THR CA HA sing N N 235 THR C O doub N N 236 THR C OXT sing N N 237 THR CB OG1 sing N N 238 THR CB CG2 sing N N 239 THR CB HB sing N N 240 THR OG1 HG1 sing N N 241 THR CG2 HG21 sing N N 242 THR CG2 HG22 sing N N 243 THR CG2 HG23 sing N N 244 THR OXT HXT sing N N 245 VAL N CA sing N N 246 VAL N H sing N N 247 VAL N H2 sing N N 248 VAL CA C sing N N 249 VAL CA CB sing N N 250 VAL CA HA sing N N 251 VAL C O doub N N 252 VAL C OXT sing N N 253 VAL CB CG1 sing N N 254 VAL CB CG2 sing N N 255 VAL CB HB sing N N 256 VAL CG1 HG11 sing N N 257 VAL CG1 HG12 sing N N 258 VAL CG1 HG13 sing N N 259 VAL CG2 HG21 sing N N 260 VAL CG2 HG22 sing N N 261 VAL CG2 HG23 sing N N 262 VAL OXT HXT sing N N 263 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2JY5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #