data_2JYS # _entry.id 2JYS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JYS pdb_00002jys 10.2210/pdb2jys/pdb RCSB RCSB100459 ? ? WWPDB D_1000100459 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-06-03 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JYS _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-12-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_id 15403 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hartl, M.J.' 1 'Woehrl, B.M.' 2 'Roesch, P.' 3 'Schweimer, K.' 4 # _citation.id primary _citation.title 'The solution structure of the simian foamy virus protease reveals a monomeric protein' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 381 _citation.page_first 141 _citation.page_last 149 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18597783 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.05.064 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hartl, M.J.' 1 ? primary 'Woehrl, B.M.' 2 ? primary 'Roesch, P.' 3 ? primary 'Schweimer, K.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protease/Reverse transcriptase' _entity.formula_weight 12409.322 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.23.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1-101' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDPLQLLQPLEAEIKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPY DYILLNPSDVPWLMKKPLQLTHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDPLQLLQPLEAEIKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPY DYILLNPSDVPWLMKKPLQLTHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 PRO n 1 4 LEU n 1 5 GLN n 1 6 LEU n 1 7 LEU n 1 8 GLN n 1 9 PRO n 1 10 LEU n 1 11 GLU n 1 12 ALA n 1 13 GLU n 1 14 ILE n 1 15 LYS n 1 16 GLY n 1 17 THR n 1 18 LYS n 1 19 LEU n 1 20 LYS n 1 21 ALA n 1 22 HIS n 1 23 TRP n 1 24 ASP n 1 25 SER n 1 26 GLY n 1 27 ALA n 1 28 THR n 1 29 ILE n 1 30 THR n 1 31 CYS n 1 32 VAL n 1 33 PRO n 1 34 GLU n 1 35 ALA n 1 36 PHE n 1 37 LEU n 1 38 GLU n 1 39 ASP n 1 40 GLU n 1 41 ARG n 1 42 PRO n 1 43 ILE n 1 44 GLN n 1 45 THR n 1 46 MET n 1 47 LEU n 1 48 ILE n 1 49 LYS n 1 50 THR n 1 51 ILE n 1 52 HIS n 1 53 GLY n 1 54 GLU n 1 55 LYS n 1 56 GLN n 1 57 GLN n 1 58 ASP n 1 59 VAL n 1 60 TYR n 1 61 TYR n 1 62 LEU n 1 63 THR n 1 64 PHE n 1 65 LYS n 1 66 VAL n 1 67 GLN n 1 68 GLY n 1 69 ARG n 1 70 LYS n 1 71 VAL n 1 72 GLU n 1 73 ALA n 1 74 GLU n 1 75 VAL n 1 76 LEU n 1 77 ALA n 1 78 SER n 1 79 PRO n 1 80 TYR n 1 81 ASP n 1 82 TYR n 1 83 ILE n 1 84 LEU n 1 85 LEU n 1 86 ASN n 1 87 PRO n 1 88 SER n 1 89 ASP n 1 90 VAL n 1 91 PRO n 1 92 TRP n 1 93 LEU n 1 94 MET n 1 95 LYS n 1 96 LYS n 1 97 PRO n 1 98 LEU n 1 99 GLN n 1 100 LEU n 1 101 THR n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name SFVmac _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Simian foamy virus type 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 338478 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET28c _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 ? ? ? A . n A 1 100 LEU 100 100 ? ? ? A . n A 1 101 THR 101 101 ? ? ? A . n A 1 102 HIS 102 102 ? ? ? A . n A 1 103 HIS 103 103 ? ? ? A . n A 1 104 HIS 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 HIS 107 107 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JYS _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JYS _struct.title 'Solution structure of Simian Foamy Virus (mac) protease' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JYS _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'retroviral protease, Hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_SFV1 _struct_ref.pdbx_db_accession P23074 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDPLQLLQPLEAEIKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPY DYILLNPSDVPWLMKKPLQLT ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JYS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23074 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 101 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JYS HIS A 102 ? UNP P23074 ? ? 'expression tag' 102 1 1 2JYS HIS A 103 ? UNP P23074 ? ? 'expression tag' 103 2 1 2JYS HIS A 104 ? UNP P23074 ? ? 'expression tag' 104 3 1 2JYS HIS A 105 ? UNP P23074 ? ? 'expression tag' 105 4 1 2JYS HIS A 106 ? UNP P23074 ? ? 'expression tag' 106 5 1 2JYS HIS A 107 ? UNP P23074 ? ? 'expression tag' 107 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 35 ? LEU A 37 ? ALA A 35 LEU A 37 5 ? 3 HELX_P HELX_P2 2 VAL A 90 ? LYS A 95 ? VAL A 90 LYS A 95 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 44 ? LYS A 49 ? GLN A 44 LYS A 49 A 2 GLU A 54 ? VAL A 66 ? GLU A 54 VAL A 66 A 3 LYS A 70 ? SER A 78 ? LYS A 70 SER A 78 A 4 THR A 30 ? PRO A 33 ? THR A 30 PRO A 33 A 5 ILE A 83 ? LEU A 85 ? ILE A 83 LEU A 85 A 6 THR A 17 ? TRP A 23 ? THR A 17 TRP A 23 A 7 LEU A 10 ? ILE A 14 ? LEU A 10 ILE A 14 A 8 GLU A 54 ? VAL A 66 ? GLU A 54 VAL A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 48 ? N ILE A 48 O LYS A 55 ? O LYS A 55 A 2 3 N TYR A 60 ? N TYR A 60 O VAL A 75 ? O VAL A 75 A 3 4 O LEU A 76 ? O LEU A 76 N VAL A 32 ? N VAL A 32 A 4 5 N CYS A 31 ? N CYS A 31 O LEU A 84 ? O LEU A 84 A 5 6 O LEU A 85 ? O LEU A 85 N HIS A 22 ? N HIS A 22 A 6 7 O THR A 17 ? O THR A 17 N ILE A 14 ? N ILE A 14 A 7 8 N GLU A 13 ? N GLU A 13 O LYS A 65 ? O LYS A 65 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TYR 60 ? ? H A VAL 75 ? ? 1.56 2 1 O A CYS 31 ? ? H A LEU 84 ? ? 1.58 3 1 O A ILE 14 ? ? H A THR 17 ? ? 1.59 4 2 O A TYR 60 ? ? H A VAL 75 ? ? 1.57 5 2 O A CYS 31 ? ? H A LEU 84 ? ? 1.57 6 4 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.58 7 4 O A CYS 31 ? ? H A LEU 84 ? ? 1.58 8 5 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.57 9 5 O A TYR 60 ? ? H A VAL 75 ? ? 1.57 10 5 H A VAL 66 ? ? O A ARG 69 ? ? 1.58 11 5 O A CYS 31 ? ? H A LEU 84 ? ? 1.58 12 6 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.55 13 6 O A TYR 60 ? ? H A VAL 75 ? ? 1.58 14 6 O A GLN 44 ? ? H A VAL 59 ? ? 1.58 15 6 H A VAL 66 ? ? O A ARG 69 ? ? 1.59 16 7 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.58 17 7 H A VAL 66 ? ? O A ARG 69 ? ? 1.60 18 8 O A TYR 60 ? ? H A VAL 75 ? ? 1.57 19 8 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.58 20 8 O A PRO 33 ? ? H A PHE 36 ? ? 1.59 21 9 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.57 22 9 O A TYR 60 ? ? H A VAL 75 ? ? 1.58 23 10 O A TYR 60 ? ? H A VAL 75 ? ? 1.55 24 11 O A GLU 34 ? ? H A LEU 37 ? ? 1.59 25 12 O A TYR 60 ? ? H A VAL 75 ? ? 1.56 26 12 O A GLN 44 ? ? H A VAL 59 ? ? 1.59 27 13 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.56 28 14 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.57 29 14 O A TYR 60 ? ? H A VAL 75 ? ? 1.58 30 15 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.57 31 15 O A CYS 31 ? ? H A LEU 84 ? ? 1.58 32 16 O A CYS 31 ? ? H A LEU 84 ? ? 1.56 33 16 O A ILE 14 ? ? H A THR 17 ? ? 1.57 34 16 H A VAL 66 ? ? O A ARG 69 ? ? 1.57 35 17 O A TYR 60 ? ? H A VAL 75 ? ? 1.56 36 18 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.56 37 18 O A TYR 60 ? ? H A VAL 75 ? ? 1.56 38 19 OD1 A ASN 86 ? ? H A SER 88 ? ? 1.57 39 19 O A CYS 31 ? ? H A LEU 84 ? ? 1.59 40 19 H A LEU 10 ? ? O A ALA 21 ? ? 1.59 41 20 H A LEU 10 ? ? O A ALA 21 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 40 ? ? -108.78 -169.23 2 1 TYR A 82 ? ? -145.46 -159.91 3 1 VAL A 90 ? ? -109.31 70.00 4 2 VAL A 90 ? ? -111.79 79.99 5 2 MET A 94 ? ? 67.75 169.93 6 2 LYS A 96 ? ? 169.76 -56.20 7 3 THR A 50 ? ? -111.31 -169.76 8 3 VAL A 90 ? ? -113.93 72.85 9 3 LYS A 96 ? ? 52.33 73.42 10 4 GLU A 38 ? ? -56.83 92.02 11 4 GLU A 40 ? ? -59.28 -178.77 12 4 TYR A 82 ? ? -141.03 -156.17 13 5 TYR A 82 ? ? -139.35 -156.82 14 6 TYR A 82 ? ? -139.49 -157.71 15 6 VAL A 90 ? ? -112.10 69.28 16 7 TYR A 80 ? ? -64.73 -178.94 17 7 TYR A 82 ? ? -142.28 -156.99 18 8 VAL A 90 ? ? -119.67 74.25 19 9 VAL A 90 ? ? -115.84 76.56 20 10 TYR A 80 ? ? -60.52 -178.99 21 10 TYR A 82 ? ? -153.61 -152.35 22 10 VAL A 90 ? ? -118.81 74.92 23 12 ASP A 39 ? ? -96.22 38.99 24 12 TYR A 82 ? ? -142.48 -154.83 25 12 VAL A 90 ? ? -110.90 73.70 26 13 ASP A 39 ? ? -94.61 40.06 27 13 GLU A 40 ? ? -39.00 135.21 28 13 ALA A 73 ? ? -160.59 -169.70 29 13 TYR A 82 ? ? -136.34 -157.80 30 14 ASP A 39 ? ? -97.08 40.21 31 14 TYR A 82 ? ? -142.27 -156.27 32 15 ASP A 39 ? ? -97.45 36.89 33 15 GLU A 40 ? ? -39.38 131.07 34 15 ALA A 73 ? ? -160.37 -169.65 35 15 TYR A 82 ? ? -139.81 -159.38 36 15 LYS A 95 ? ? 45.12 -94.17 37 15 LYS A 96 ? ? 64.69 60.89 38 16 ASP A 39 ? ? -99.41 37.16 39 16 GLU A 40 ? ? -38.69 134.11 40 16 TYR A 82 ? ? -148.14 -159.32 41 16 VAL A 90 ? ? -119.25 71.68 42 17 ASP A 39 ? ? -97.05 40.15 43 17 TYR A 82 ? ? -139.22 -157.89 44 18 THR A 50 ? ? -121.18 -168.72 45 18 TYR A 82 ? ? -145.08 -153.97 46 18 VAL A 90 ? ? -116.06 73.95 47 19 VAL A 90 ? ? -119.52 76.39 48 20 ASP A 39 ? ? -98.52 37.67 49 20 GLU A 40 ? ? -38.70 132.70 50 20 VAL A 90 ? ? -108.18 69.64 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 41 ? ? 0.315 'SIDE CHAIN' 2 1 ARG A 69 ? ? 0.127 'SIDE CHAIN' 3 2 ARG A 41 ? ? 0.245 'SIDE CHAIN' 4 2 ARG A 69 ? ? 0.317 'SIDE CHAIN' 5 3 ARG A 41 ? ? 0.228 'SIDE CHAIN' 6 3 ARG A 69 ? ? 0.318 'SIDE CHAIN' 7 4 ARG A 41 ? ? 0.240 'SIDE CHAIN' 8 4 ARG A 69 ? ? 0.317 'SIDE CHAIN' 9 5 ARG A 41 ? ? 0.292 'SIDE CHAIN' 10 5 ARG A 69 ? ? 0.207 'SIDE CHAIN' 11 6 ARG A 41 ? ? 0.315 'SIDE CHAIN' 12 6 ARG A 69 ? ? 0.317 'SIDE CHAIN' 13 7 ARG A 41 ? ? 0.304 'SIDE CHAIN' 14 7 ARG A 69 ? ? 0.317 'SIDE CHAIN' 15 8 ARG A 41 ? ? 0.235 'SIDE CHAIN' 16 8 ARG A 69 ? ? 0.168 'SIDE CHAIN' 17 9 ARG A 41 ? ? 0.264 'SIDE CHAIN' 18 9 ARG A 69 ? ? 0.192 'SIDE CHAIN' 19 10 ARG A 41 ? ? 0.213 'SIDE CHAIN' 20 10 ARG A 69 ? ? 0.280 'SIDE CHAIN' 21 11 ARG A 41 ? ? 0.214 'SIDE CHAIN' 22 11 ARG A 69 ? ? 0.284 'SIDE CHAIN' 23 12 ARG A 41 ? ? 0.274 'SIDE CHAIN' 24 13 ARG A 41 ? ? 0.201 'SIDE CHAIN' 25 13 ARG A 69 ? ? 0.276 'SIDE CHAIN' 26 14 ARG A 41 ? ? 0.249 'SIDE CHAIN' 27 14 ARG A 69 ? ? 0.317 'SIDE CHAIN' 28 15 ARG A 41 ? ? 0.161 'SIDE CHAIN' 29 15 ARG A 69 ? ? 0.078 'SIDE CHAIN' 30 16 ARG A 41 ? ? 0.273 'SIDE CHAIN' 31 16 ARG A 69 ? ? 0.208 'SIDE CHAIN' 32 17 ARG A 41 ? ? 0.196 'SIDE CHAIN' 33 17 ARG A 69 ? ? 0.289 'SIDE CHAIN' 34 18 ARG A 41 ? ? 0.169 'SIDE CHAIN' 35 18 ARG A 69 ? ? 0.275 'SIDE CHAIN' 36 19 ARG A 41 ? ? 0.312 'SIDE CHAIN' 37 19 ARG A 69 ? ? 0.316 'SIDE CHAIN' 38 20 ARG A 41 ? ? 0.192 'SIDE CHAIN' 39 20 ARG A 69 ? ? 0.304 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 120 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JYS _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JYS _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '2mM [U-98% 13C; U-98% 15N] protein, 50mM sodium phosphate, 100mM sodium chloride, 0.5mM DTT, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity 2 mM '[U-98% 13C; U-98% 15N]' 1 'sodium phosphate' 50 mM ? 1 'sodium chloride' 100 mM ? 1 DTT 0.5 mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2JYS _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR-NIH ? 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement X-PLOR-NIH ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A GLN 99 ? A GLN 99 9 1 Y 1 A LEU 100 ? A LEU 100 10 1 Y 1 A THR 101 ? A THR 101 11 1 Y 1 A HIS 102 ? A HIS 102 12 1 Y 1 A HIS 103 ? A HIS 103 13 1 Y 1 A HIS 104 ? A HIS 104 14 1 Y 1 A HIS 105 ? A HIS 105 15 1 Y 1 A HIS 106 ? A HIS 106 16 1 Y 1 A HIS 107 ? A HIS 107 17 2 Y 1 A MET 1 ? A MET 1 18 2 Y 1 A ASP 2 ? A ASP 2 19 2 Y 1 A PRO 3 ? A PRO 3 20 2 Y 1 A LEU 4 ? A LEU 4 21 2 Y 1 A GLN 5 ? A GLN 5 22 2 Y 1 A LEU 6 ? A LEU 6 23 2 Y 1 A LEU 7 ? A LEU 7 24 2 Y 1 A GLN 99 ? A GLN 99 25 2 Y 1 A LEU 100 ? A LEU 100 26 2 Y 1 A THR 101 ? A THR 101 27 2 Y 1 A HIS 102 ? A HIS 102 28 2 Y 1 A HIS 103 ? A HIS 103 29 2 Y 1 A HIS 104 ? A HIS 104 30 2 Y 1 A HIS 105 ? A HIS 105 31 2 Y 1 A HIS 106 ? A HIS 106 32 2 Y 1 A HIS 107 ? A HIS 107 33 3 Y 1 A MET 1 ? A MET 1 34 3 Y 1 A ASP 2 ? A ASP 2 35 3 Y 1 A PRO 3 ? A PRO 3 36 3 Y 1 A LEU 4 ? A LEU 4 37 3 Y 1 A GLN 5 ? A GLN 5 38 3 Y 1 A LEU 6 ? A LEU 6 39 3 Y 1 A LEU 7 ? A LEU 7 40 3 Y 1 A GLN 99 ? A GLN 99 41 3 Y 1 A LEU 100 ? A LEU 100 42 3 Y 1 A THR 101 ? A THR 101 43 3 Y 1 A HIS 102 ? A HIS 102 44 3 Y 1 A HIS 103 ? A HIS 103 45 3 Y 1 A HIS 104 ? A HIS 104 46 3 Y 1 A HIS 105 ? A HIS 105 47 3 Y 1 A HIS 106 ? A HIS 106 48 3 Y 1 A HIS 107 ? A HIS 107 49 4 Y 1 A MET 1 ? A MET 1 50 4 Y 1 A ASP 2 ? A ASP 2 51 4 Y 1 A PRO 3 ? A PRO 3 52 4 Y 1 A LEU 4 ? A LEU 4 53 4 Y 1 A GLN 5 ? A GLN 5 54 4 Y 1 A LEU 6 ? A LEU 6 55 4 Y 1 A LEU 7 ? A LEU 7 56 4 Y 1 A GLN 99 ? A GLN 99 57 4 Y 1 A LEU 100 ? A LEU 100 58 4 Y 1 A THR 101 ? A THR 101 59 4 Y 1 A HIS 102 ? A HIS 102 60 4 Y 1 A HIS 103 ? A HIS 103 61 4 Y 1 A HIS 104 ? A HIS 104 62 4 Y 1 A HIS 105 ? A HIS 105 63 4 Y 1 A HIS 106 ? A HIS 106 64 4 Y 1 A HIS 107 ? A HIS 107 65 5 Y 1 A MET 1 ? A MET 1 66 5 Y 1 A ASP 2 ? A ASP 2 67 5 Y 1 A PRO 3 ? A PRO 3 68 5 Y 1 A LEU 4 ? A LEU 4 69 5 Y 1 A GLN 5 ? A GLN 5 70 5 Y 1 A LEU 6 ? A LEU 6 71 5 Y 1 A LEU 7 ? A LEU 7 72 5 Y 1 A GLN 99 ? A GLN 99 73 5 Y 1 A LEU 100 ? A LEU 100 74 5 Y 1 A THR 101 ? A THR 101 75 5 Y 1 A HIS 102 ? A HIS 102 76 5 Y 1 A HIS 103 ? A HIS 103 77 5 Y 1 A HIS 104 ? A HIS 104 78 5 Y 1 A HIS 105 ? A HIS 105 79 5 Y 1 A HIS 106 ? A HIS 106 80 5 Y 1 A HIS 107 ? A HIS 107 81 6 Y 1 A MET 1 ? A MET 1 82 6 Y 1 A ASP 2 ? A ASP 2 83 6 Y 1 A PRO 3 ? A PRO 3 84 6 Y 1 A LEU 4 ? A LEU 4 85 6 Y 1 A GLN 5 ? A GLN 5 86 6 Y 1 A LEU 6 ? A LEU 6 87 6 Y 1 A LEU 7 ? A LEU 7 88 6 Y 1 A GLN 99 ? A GLN 99 89 6 Y 1 A LEU 100 ? A LEU 100 90 6 Y 1 A THR 101 ? A THR 101 91 6 Y 1 A HIS 102 ? A HIS 102 92 6 Y 1 A HIS 103 ? A HIS 103 93 6 Y 1 A HIS 104 ? A HIS 104 94 6 Y 1 A HIS 105 ? A HIS 105 95 6 Y 1 A HIS 106 ? A HIS 106 96 6 Y 1 A HIS 107 ? A HIS 107 97 7 Y 1 A MET 1 ? A MET 1 98 7 Y 1 A ASP 2 ? A ASP 2 99 7 Y 1 A PRO 3 ? A PRO 3 100 7 Y 1 A LEU 4 ? A LEU 4 101 7 Y 1 A GLN 5 ? A GLN 5 102 7 Y 1 A LEU 6 ? A LEU 6 103 7 Y 1 A LEU 7 ? A LEU 7 104 7 Y 1 A GLN 99 ? A GLN 99 105 7 Y 1 A LEU 100 ? A LEU 100 106 7 Y 1 A THR 101 ? A THR 101 107 7 Y 1 A HIS 102 ? A HIS 102 108 7 Y 1 A HIS 103 ? A HIS 103 109 7 Y 1 A HIS 104 ? A HIS 104 110 7 Y 1 A HIS 105 ? A HIS 105 111 7 Y 1 A HIS 106 ? A HIS 106 112 7 Y 1 A HIS 107 ? A HIS 107 113 8 Y 1 A MET 1 ? A MET 1 114 8 Y 1 A ASP 2 ? A ASP 2 115 8 Y 1 A PRO 3 ? A PRO 3 116 8 Y 1 A LEU 4 ? A LEU 4 117 8 Y 1 A GLN 5 ? A GLN 5 118 8 Y 1 A LEU 6 ? A LEU 6 119 8 Y 1 A LEU 7 ? A LEU 7 120 8 Y 1 A GLN 99 ? A GLN 99 121 8 Y 1 A LEU 100 ? A LEU 100 122 8 Y 1 A THR 101 ? A THR 101 123 8 Y 1 A HIS 102 ? A HIS 102 124 8 Y 1 A HIS 103 ? A HIS 103 125 8 Y 1 A HIS 104 ? A HIS 104 126 8 Y 1 A HIS 105 ? A HIS 105 127 8 Y 1 A HIS 106 ? A HIS 106 128 8 Y 1 A HIS 107 ? A HIS 107 129 9 Y 1 A MET 1 ? A MET 1 130 9 Y 1 A ASP 2 ? A ASP 2 131 9 Y 1 A PRO 3 ? A PRO 3 132 9 Y 1 A LEU 4 ? A LEU 4 133 9 Y 1 A GLN 5 ? A GLN 5 134 9 Y 1 A LEU 6 ? A LEU 6 135 9 Y 1 A LEU 7 ? A LEU 7 136 9 Y 1 A GLN 99 ? A GLN 99 137 9 Y 1 A LEU 100 ? A LEU 100 138 9 Y 1 A THR 101 ? A THR 101 139 9 Y 1 A HIS 102 ? A HIS 102 140 9 Y 1 A HIS 103 ? A HIS 103 141 9 Y 1 A HIS 104 ? A HIS 104 142 9 Y 1 A HIS 105 ? A HIS 105 143 9 Y 1 A HIS 106 ? A HIS 106 144 9 Y 1 A HIS 107 ? A HIS 107 145 10 Y 1 A MET 1 ? A MET 1 146 10 Y 1 A ASP 2 ? A ASP 2 147 10 Y 1 A PRO 3 ? A PRO 3 148 10 Y 1 A LEU 4 ? A LEU 4 149 10 Y 1 A GLN 5 ? A GLN 5 150 10 Y 1 A LEU 6 ? A LEU 6 151 10 Y 1 A LEU 7 ? A LEU 7 152 10 Y 1 A GLN 99 ? A GLN 99 153 10 Y 1 A LEU 100 ? A LEU 100 154 10 Y 1 A THR 101 ? A THR 101 155 10 Y 1 A HIS 102 ? A HIS 102 156 10 Y 1 A HIS 103 ? A HIS 103 157 10 Y 1 A HIS 104 ? A HIS 104 158 10 Y 1 A HIS 105 ? A HIS 105 159 10 Y 1 A HIS 106 ? A HIS 106 160 10 Y 1 A HIS 107 ? A HIS 107 161 11 Y 1 A MET 1 ? A MET 1 162 11 Y 1 A ASP 2 ? A ASP 2 163 11 Y 1 A PRO 3 ? A PRO 3 164 11 Y 1 A LEU 4 ? A LEU 4 165 11 Y 1 A GLN 5 ? A GLN 5 166 11 Y 1 A LEU 6 ? A LEU 6 167 11 Y 1 A LEU 7 ? A LEU 7 168 11 Y 1 A GLN 99 ? A GLN 99 169 11 Y 1 A LEU 100 ? A LEU 100 170 11 Y 1 A THR 101 ? A THR 101 171 11 Y 1 A HIS 102 ? A HIS 102 172 11 Y 1 A HIS 103 ? A HIS 103 173 11 Y 1 A HIS 104 ? A HIS 104 174 11 Y 1 A HIS 105 ? A HIS 105 175 11 Y 1 A HIS 106 ? A HIS 106 176 11 Y 1 A HIS 107 ? A HIS 107 177 12 Y 1 A MET 1 ? A MET 1 178 12 Y 1 A ASP 2 ? A ASP 2 179 12 Y 1 A PRO 3 ? A PRO 3 180 12 Y 1 A LEU 4 ? A LEU 4 181 12 Y 1 A GLN 5 ? A GLN 5 182 12 Y 1 A LEU 6 ? A LEU 6 183 12 Y 1 A LEU 7 ? A LEU 7 184 12 Y 1 A GLN 99 ? A GLN 99 185 12 Y 1 A LEU 100 ? A LEU 100 186 12 Y 1 A THR 101 ? A THR 101 187 12 Y 1 A HIS 102 ? A HIS 102 188 12 Y 1 A HIS 103 ? A HIS 103 189 12 Y 1 A HIS 104 ? A HIS 104 190 12 Y 1 A HIS 105 ? A HIS 105 191 12 Y 1 A HIS 106 ? A HIS 106 192 12 Y 1 A HIS 107 ? A HIS 107 193 13 Y 1 A MET 1 ? A MET 1 194 13 Y 1 A ASP 2 ? A ASP 2 195 13 Y 1 A PRO 3 ? A PRO 3 196 13 Y 1 A LEU 4 ? A LEU 4 197 13 Y 1 A GLN 5 ? A GLN 5 198 13 Y 1 A LEU 6 ? A LEU 6 199 13 Y 1 A LEU 7 ? A LEU 7 200 13 Y 1 A GLN 99 ? A GLN 99 201 13 Y 1 A LEU 100 ? A LEU 100 202 13 Y 1 A THR 101 ? A THR 101 203 13 Y 1 A HIS 102 ? A HIS 102 204 13 Y 1 A HIS 103 ? A HIS 103 205 13 Y 1 A HIS 104 ? A HIS 104 206 13 Y 1 A HIS 105 ? A HIS 105 207 13 Y 1 A HIS 106 ? A HIS 106 208 13 Y 1 A HIS 107 ? A HIS 107 209 14 Y 1 A MET 1 ? A MET 1 210 14 Y 1 A ASP 2 ? A ASP 2 211 14 Y 1 A PRO 3 ? A PRO 3 212 14 Y 1 A LEU 4 ? A LEU 4 213 14 Y 1 A GLN 5 ? A GLN 5 214 14 Y 1 A LEU 6 ? A LEU 6 215 14 Y 1 A LEU 7 ? A LEU 7 216 14 Y 1 A GLN 99 ? A GLN 99 217 14 Y 1 A LEU 100 ? A LEU 100 218 14 Y 1 A THR 101 ? A THR 101 219 14 Y 1 A HIS 102 ? A HIS 102 220 14 Y 1 A HIS 103 ? A HIS 103 221 14 Y 1 A HIS 104 ? A HIS 104 222 14 Y 1 A HIS 105 ? A HIS 105 223 14 Y 1 A HIS 106 ? A HIS 106 224 14 Y 1 A HIS 107 ? A HIS 107 225 15 Y 1 A MET 1 ? A MET 1 226 15 Y 1 A ASP 2 ? A ASP 2 227 15 Y 1 A PRO 3 ? A PRO 3 228 15 Y 1 A LEU 4 ? A LEU 4 229 15 Y 1 A GLN 5 ? A GLN 5 230 15 Y 1 A LEU 6 ? A LEU 6 231 15 Y 1 A LEU 7 ? A LEU 7 232 15 Y 1 A GLN 99 ? A GLN 99 233 15 Y 1 A LEU 100 ? A LEU 100 234 15 Y 1 A THR 101 ? A THR 101 235 15 Y 1 A HIS 102 ? A HIS 102 236 15 Y 1 A HIS 103 ? A HIS 103 237 15 Y 1 A HIS 104 ? A HIS 104 238 15 Y 1 A HIS 105 ? A HIS 105 239 15 Y 1 A HIS 106 ? A HIS 106 240 15 Y 1 A HIS 107 ? A HIS 107 241 16 Y 1 A MET 1 ? A MET 1 242 16 Y 1 A ASP 2 ? A ASP 2 243 16 Y 1 A PRO 3 ? A PRO 3 244 16 Y 1 A LEU 4 ? A LEU 4 245 16 Y 1 A GLN 5 ? A GLN 5 246 16 Y 1 A LEU 6 ? A LEU 6 247 16 Y 1 A LEU 7 ? A LEU 7 248 16 Y 1 A GLN 99 ? A GLN 99 249 16 Y 1 A LEU 100 ? A LEU 100 250 16 Y 1 A THR 101 ? A THR 101 251 16 Y 1 A HIS 102 ? A HIS 102 252 16 Y 1 A HIS 103 ? A HIS 103 253 16 Y 1 A HIS 104 ? A HIS 104 254 16 Y 1 A HIS 105 ? A HIS 105 255 16 Y 1 A HIS 106 ? A HIS 106 256 16 Y 1 A HIS 107 ? A HIS 107 257 17 Y 1 A MET 1 ? A MET 1 258 17 Y 1 A ASP 2 ? A ASP 2 259 17 Y 1 A PRO 3 ? A PRO 3 260 17 Y 1 A LEU 4 ? A LEU 4 261 17 Y 1 A GLN 5 ? A GLN 5 262 17 Y 1 A LEU 6 ? A LEU 6 263 17 Y 1 A LEU 7 ? A LEU 7 264 17 Y 1 A GLN 99 ? A GLN 99 265 17 Y 1 A LEU 100 ? A LEU 100 266 17 Y 1 A THR 101 ? A THR 101 267 17 Y 1 A HIS 102 ? A HIS 102 268 17 Y 1 A HIS 103 ? A HIS 103 269 17 Y 1 A HIS 104 ? A HIS 104 270 17 Y 1 A HIS 105 ? A HIS 105 271 17 Y 1 A HIS 106 ? A HIS 106 272 17 Y 1 A HIS 107 ? A HIS 107 273 18 Y 1 A MET 1 ? A MET 1 274 18 Y 1 A ASP 2 ? A ASP 2 275 18 Y 1 A PRO 3 ? A PRO 3 276 18 Y 1 A LEU 4 ? A LEU 4 277 18 Y 1 A GLN 5 ? A GLN 5 278 18 Y 1 A LEU 6 ? A LEU 6 279 18 Y 1 A LEU 7 ? A LEU 7 280 18 Y 1 A GLN 99 ? A GLN 99 281 18 Y 1 A LEU 100 ? A LEU 100 282 18 Y 1 A THR 101 ? A THR 101 283 18 Y 1 A HIS 102 ? A HIS 102 284 18 Y 1 A HIS 103 ? A HIS 103 285 18 Y 1 A HIS 104 ? A HIS 104 286 18 Y 1 A HIS 105 ? A HIS 105 287 18 Y 1 A HIS 106 ? A HIS 106 288 18 Y 1 A HIS 107 ? A HIS 107 289 19 Y 1 A MET 1 ? A MET 1 290 19 Y 1 A ASP 2 ? A ASP 2 291 19 Y 1 A PRO 3 ? A PRO 3 292 19 Y 1 A LEU 4 ? A LEU 4 293 19 Y 1 A GLN 5 ? A GLN 5 294 19 Y 1 A LEU 6 ? A LEU 6 295 19 Y 1 A LEU 7 ? A LEU 7 296 19 Y 1 A GLN 99 ? A GLN 99 297 19 Y 1 A LEU 100 ? A LEU 100 298 19 Y 1 A THR 101 ? A THR 101 299 19 Y 1 A HIS 102 ? A HIS 102 300 19 Y 1 A HIS 103 ? A HIS 103 301 19 Y 1 A HIS 104 ? A HIS 104 302 19 Y 1 A HIS 105 ? A HIS 105 303 19 Y 1 A HIS 106 ? A HIS 106 304 19 Y 1 A HIS 107 ? A HIS 107 305 20 Y 1 A MET 1 ? A MET 1 306 20 Y 1 A ASP 2 ? A ASP 2 307 20 Y 1 A PRO 3 ? A PRO 3 308 20 Y 1 A LEU 4 ? A LEU 4 309 20 Y 1 A GLN 5 ? A GLN 5 310 20 Y 1 A LEU 6 ? A LEU 6 311 20 Y 1 A LEU 7 ? A LEU 7 312 20 Y 1 A GLN 99 ? A GLN 99 313 20 Y 1 A LEU 100 ? A LEU 100 314 20 Y 1 A THR 101 ? A THR 101 315 20 Y 1 A HIS 102 ? A HIS 102 316 20 Y 1 A HIS 103 ? A HIS 103 317 20 Y 1 A HIS 104 ? A HIS 104 318 20 Y 1 A HIS 105 ? A HIS 105 319 20 Y 1 A HIS 106 ? A HIS 106 320 20 Y 1 A HIS 107 ? A HIS 107 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2JYS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_